DRAVP ID  DRAVPe01754

Peptide Name   MERS-S (1252-1286)

Sequence  LTQINTTLLDLTYEMLSLQQVVKALNESYIDLKEL

Sequence Length  35

UniProt ID  K9N5Q8  R9UQ53 

Taxon ID  None

Source  Synthetic construct

Validation   Experimentally Validated

Gene Name/ID  Not Available

GenBank  Not Available

Amino Acid position  Not Available

Domain Accession ID  Not Available

Nucleotide sequence ID  Not Available

Molecular Type  Not Available

Chromosomal Position  Not Available

Target Organism  MERS-CoV PsV

Assay  pseudovirus entry inhibition assay

Activity 

• [Ref.24067982]MERS-COV(Middle East respiratory syndrome coronavirus): inhibition of MERS-CoV PsV infection in 293T/Huh7 cells (EC50~3.013µM).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity  No cytotoxicity information found in the reference(s) presented

Binding Target  membrane

Mechanism  inhibit MERS-CoV fusion and entry by using a pseudotyped-virus system

PDB ID  None

Predicted Structure Download  No predicted structure available

Linear/Cyclic  Linear

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Stereochemistry  L

Literature 1

Title   Structure of the fusion core and inhibition of fusion by a heptad repeat peptide derived from the S protein of Middle East respiratory syndrome coronavirus.

Pubmed ID   24067982

Reference   J Virol. 2013 Dec;87(24):13134-40.

Author   Gao J, Lu G, Qi J, Li Y, Wu Y, Deng Y, Geng H, Li H, Wang Q, Xiao H, Tan W, Yan J, Gao GF.

DOI   10.1128/JVI.02433-13