General Information
DRAVP ID DRAVPe01754
Peptide Name MERS-S (1252-1286)
Sequence LTQINTTLLDLTYEMLSLQQVVKALNESYIDLKEL
Sequence Length 35
Taxon ID None
Source Synthetic construct
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not Available
Activity Information
Target Organism MERS-CoV PsV
Assay pseudovirus entry inhibition assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity No cytotoxicity information found in the reference(s) presented
Binding Target membrane
Mechanism inhibit MERS-CoV fusion and entry by using a pseudotyped-virus system
Structure Information
PDB ID None
Predicted Structure Download No predicted structure available
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C182H302N42O59S
Absent amino acids CFGHPRW
Common amino acids L
Mass 4054.71
Pl 4.18
Basic residues 2
Acidic residues 5
Hydrophobic residues 14
Net charge -3
Boman Index -2987
Hydrophobicity 15.71
Aliphatic Index 142
Half Life
Extinction Coefficient cystines 2980
Absorbance 280nm 87.65
Polar residues 10
Literature Information
Literature 1
Title Structure of the fusion core and inhibition of fusion by a heptad repeat peptide derived from the S protein of Middle East respiratory syndrome coronavirus.
Pubmed ID 24067982
Reference J Virol. 2013 Dec;87(24):13134-40.
Author Gao J, Lu G, Qi J, Li Y, Wu Y, Deng Y, Geng H, Li H, Wang Q, Xiao H, Tan W, Yan J, Gao GF.