General Information

General Information

DRAVP ID DRAVPe01755

Peptide Name MERS-CoV-HR2P [T1263E,L1267R]

Sequence SLTQINTTLLDLEYEMRSLQQVVKALNESYIDLKEL

Sequence Length 36

UniProt ID K9N5Q8

Source Synthetic construct

Activity Information

Target Organism MERS-CoV

Assay Cell–cell fusion

Activity

[Ref.24473083]MERS-COV(Middle East respiratory syndrome coronavirus): inhibition of cell–cell fusion infection in Huh-7 and 293T/MERS/EGFP cells (IC50=0.93±0.15µM); inhibition of MERS-CoV infection in Vero cells (IC50=0.6µM); inhibition of MERS-CoV infection in Calu-3 cells (IC50=0.6µM); inhibition of MERS-CoV infection in HFL cells (IC50=13.9µM).

Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity

[Ref.24473083]HR2P has low or no in vitro toxic effect.

Binding Target HR1 domain

Mechanism interact with the viral HR1 domain to form heterologous 6-HB and block viral fusion coreformation, resulting in inhibition of MERS-CoV S protein-mediated membrane fusion.

Structure Information

PDB ID None

Predicted Structure Download No predicted structure available

Linear/Cyclic Linear

N-terminal Modification Free

C-terminal Modification Free

Other Modification None

Stereochemistry L

Physicochemical Information

Formula C186H308N46O62S

Absent amino acids CFGHPW

Common amino acids L

Mass 4212.82

Pl 4.36

Basic residues 3

Acidic residues 6

Hydrophobic residues 13

Net charge -3

Boman Index -5735

Hydrophobicity -17.78

Aliphatic Index 127.22

Half Life

Mammalian:1.9 hour
Yeast:>20 hour
E.coli:>10 hour

Extinction Coefficient cystines 2980

Absorbance 280nm 85.14

Polar residues 10

Literature Information

Literature 1

Title Structure-based discovery of Middle East respiratory syndrome coronavirus fusion inhibitor.

Pubmed ID 24473083

Reference Nat Commun. 2014;5:3067.

Author Lu L, Liu Q, Zhu Y, Chan KH, Qin L, Li Y, Wang Q, Chan JF, Du L, Yu F, Ma C, Ye S, Yuen KY, Zhang R, Jiang S.

DOI 10.1038/ncomms4067