DRAVP ID  DRAVPe01755

Peptide Name   MERS-CoV-HR2P [T1263E,L1267R]

Sequence  SLTQINTTLLDLEYEMRSLQQVVKALNESYIDLKEL

Sequence Length  36

UniProt ID  K9N5Q8 

Taxon ID  None

Source  Synthetic construct

Validation   Experimentally Validated

Gene Name/ID  Not Available

GenBank  Not Available

Amino Acid position  Not Available

Domain Accession ID  Not Available

Nucleotide sequence ID  Not Available

Molecular Type  Not Available

Chromosomal Position  Not Available

Target Organism  MERS-CoV

Assay  Cell–cell fusion

Activity 

• [Ref.24473083]MERS-COV(Middle East respiratory syndrome coronavirus): inhibition of cell–cell fusion infection in Huh-7 and 293T/MERS/EGFP cells (IC50=0.93±0.15µM); inhibition of MERS-CoV infection in Vero cells (IC50=0.6µM); inhibition of MERS-CoV infection in Calu-3 cells (IC50=0.6µM); inhibition of MERS-CoV infection in HFL cells (IC50=13.9µM).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity 

• [Ref.24473083]HR2P has low or no in vitro toxic effect.

Binding Target  HR1 domain

Mechanism  interact with the viral HR1 domain to form heterologous 6-HB and block viral fusion coreformation, resulting in inhibition of MERS-CoV S protein-mediated membrane fusion.

PDB ID  None

Predicted Structure Download  No predicted structure available

Linear/Cyclic  Linear

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Stereochemistry  L

Literature 1

Title   Structure-based discovery of Middle East respiratory syndrome coronavirus fusion inhibitor.

Pubmed ID   24473083

Reference   Nat Commun. 2014;5:3067.

Author   Lu L, Liu Q, Zhu Y, Chan KH, Qin L, Li Y, Wang Q, Chan JF, Du L, Yu F, Ma C, Ye S, Yuen KY, Zhang R, Jiang S.

DOI   10.1038/ncomms4067