General Information


DRAVP ID  DRAVPe01756

Peptide Name   SARS-CoV Sgp (471-503)

Sequence  ALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFEL

Sequence Length  33

UniProt ID  P59594 

Taxon ID  None

Source  Synthetic construct

Validation   Experimentally Validated



Origin Information


Gene Name/ID  Not Available

GenBank  Not Available

Amino Acid position  Not Available

Domain Accession ID  Not Available

Nucleotide sequence ID  Not Available

Molecular Type  Not Available

Chromosomal Position  Not Available



Activity Information


Target Organism  SARS-CoV

Assay  Plaque reduction assay

Activity 

  • [Ref.16153058]SARS-CoV(Severe acute respiratory syndrome): inhibition of SARS-CoV infction in Vero cells (EC50=41.6µM).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity  No cytotoxicity information found in the reference(s) presented

Binding Target  not found

Mechanism  block the binding between the RBD and angiotensin-convertingenzyme 2, resulting in the inhibition of SARS-CoV entrance into host cells in vitro



Structure Information


PDB ID  None

Predicted Structure Download  No predicted structure available

Linear/Cyclic  Linear

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Stereochemistry  L



Physicochemical Information


Formula  C184H260N40O50S

Absent amino acids  HKM

Common amino acids  Y

Mass  3864.39

Pl  4.37

Basic residues  1

Acidic residues  2

Hydrophobic residues  12

Net charge  -1

Boman Index  -1016

Hydrophobicity  16.67

Aliphatic Index  88.48

Half Life 

  •     Mammalian:4.4 hour
  •     Yeast:>20 hour
  •     E.coli:>10 hour

Extinction Coefficient cystines  12950

Absorbance 280nm  404.69

Polar residues  15



Literature Information


Literature 1

Title   Screening and identification of linear B-cell epitopes and entry-blocking peptide of severe acute respiratory syndrome (SARS)-associated coronavirus using synthetic overlapping peptide library.

Pubmed ID   16153058

Reference   J Comb Chem. 2005 Sep-Oct;7(5):648-56.

Author   Hu H, Li L, Kao RY, Kou B, Wang Z, Zhang L, Zhang H, Hao Z, Tsui WH, Ni A, Cui L, Fan B, Guo F, Rao S, Jiang C, Li Q, Sun M, He W, Liu G.

DOI   10.1021/cc0500607