To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
General Information
DRAVP ID DRAVPe01756
Peptide Name SARS-CoV Sgp (471-503)
Sequence ALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFEL
Sequence Length 33
UniProt ID P59594
Source Synthetic construct
Activity Information
Target Organism SARS-CoV
Assay Plaque reduction assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity No cytotoxicity information found in the reference(s) presented
Binding Target not found
Mechanism block the binding between the RBD and angiotensin-convertingenzyme 2, resulting in the inhibition of SARS-CoV entrance into host cells in vitro
Structure Information
PDB ID None
Predicted Structure Download No predicted structure available
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C184H260N40O50S
Absent amino acids HKM
Common amino acids Y
Mass 3864.39
Pl 4.37
Basic residues 1
Acidic residues 2
Hydrophobic residues 12
Net charge -1
Boman Index -1016
Hydrophobicity 16.67
Aliphatic Index 88.48
Half Life
Extinction Coefficient cystines 12950
Absorbance 280nm 404.69
Polar residues 15
Literature Information
Literature 1
Title Screening and identification of linear B-cell epitopes and entry-blocking peptide of severe acute respiratory syndrome (SARS)-associated coronavirus using synthetic overlapping peptide library.
Pubmed ID 16153058
Reference J Comb Chem. 2005 Sep-Oct;7(5):648-56.
Author Hu H, Li L, Kao RY, Kou B, Wang Z, Zhang L, Zhang H, Hao Z, Tsui WH, Ni A, Cui L, Fan B, Guo F, Rao S, Jiang C, Li Q, Sun M, He W, Liu G.
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.