General Information


DRAVP ID  DRAVPe01761

Peptide Name   MBD-4 (11-40)(P9)

Sequence  NGAICWGPCPTAFRQIGNCGHFKVRCCKIR

Sequence Length  30

UniProt ID  P82019 

Taxon ID  10090 

Source  Synthetic construct

Validation   Experimentally Validated



Origin Information


Gene Name/ID  Defb4

GenBank  AF155882.2

Amino Acid position  Not available

Domain Accession ID  pfam00711 

Nucleotide sequence ID  AF155882 

Molecular Type  mRNA

Chromosomal Position  Chromosome 8, Location: NC_000074.7 (19213172..19245342)



Activity Information


Target Organism  SARS-CoV-2

Assay  Plaque reduction assay

Activity 

  • [Ref.32843628]SARS-CoV-2:Inhibition of infection in Vero E6 cells(IC50=2.4 µg/ml);
  • SARS-CoV:Inhibition of infection in Vero E6 cells(IC50=6.2 µg/ml);
  • MERS-CoV:Inhibition of infection in Vero E6 cells(IC50=8.8 µg/ml);
  • Human rhinovirus (HRV):inhibition of infection in RD cells(IC50=34 µg/ml);
  • Human parainfluenza virus 3:Inhibition of infection in LLC-MK2 cells(IC50>25 µg/ml);
  • Human Influenza A Virus H1N1:Inhibition of infection In MDCK cells(IC50=1.6 µg/ml);
  • Human Influenza A Virus H7N9:Inhibition of infection In MDCK cells(IC50=3.3 µg/ml).
  • [Ref.26911565]Human Influenza A Virus H1N1(IC50=1.2 µg/ml);Human Influenza A Virus H3N2(IC50=1.2 µg/ml);Human Influenza A Virus H5N1(IC50=2.4 µg/ml);Human Influenza A Virus H7N7(IC50=0.8 µg/ml);Human Influenza A Virus H7N9(IC50=4.6 µg/ml);MERS-CoV(IC50=4.8 µg/ml);SARS-CoV(IC50=4.8 µg/ml)

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity 

  • [Ref.26911565]Cytotoxicity against Madin-Darby canine kidney cells(TC50=380 μg/ml).

Binding Target  Not found

Mechanism  Mechanistic studies show that positively charged P9 broadly inhibits viral replication by binding to different viruses and then inhibits virus–host endosomal acidification to prevent the endosomal release of pH-dependent viruses.



Structure Information


PDB ID  6M56 

Predicted Structure Download  No predicted structure available

Linear/Cyclic  Linear

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Stereochemistry  L



Physicochemical Information


Formula  C144H227N47O35S5

Absent amino acids  DELMSY

Common amino acids  C

Mass  3336.98

Pl  9.41

Basic residues  6

Acidic residues  0

Hydrophobic residues  9

Net charge  6

Boman Index  -4104

Hydrophobicity  -6.67

Aliphatic Index  55.33

Half Life 

  •     Mammalian:1.4 hour
  •     Yeast:3 min
  •     E.coli:>10 hour

Extinction Coefficient cystines  5750

Absorbance 280nm  198.28

Polar residues  12



Literature Information


Literature 1

Title   A novel peptide with potent and broad-spectrum antiviral activities against multiple respiratory viruses.

Pubmed ID   26911565

Reference   Sci Rep. 2016 Feb 25;6:22008.

Author   Zhao H, Zhou J, Zhang K, Chu H, Liu D, Poon VK, Chan CC, Leung HC, Fai N, Lin YP, Zhang AJ, Jin DY, Yuen KY, Zheng BJ.

DOI   10.1038/srep22008

Literature 2

Title   A broad-spectrum virus- and host-targeting peptide against respiratory viruses including influenza virus and SARS-CoV-2.

Pubmed ID   32843628

Reference   Nat Commun. 2020 Aug 25;11(1):4252.

Author   Zhao H, To KKW, Sze KH, Yung TT, Bian M, Lam H, Yeung ML, Li C, Chu H, Yuen KY.

DOI   10.1038/s41467-020-17986-9