General Information

General Information

DRAVP ID DRAVPe01761

Peptide Name MBD-4 (11-40)(P9)

Sequence NGAICWGPCPTAFRQIGNCGHFKVRCCKIR

Sequence Length 30

UniProt ID P82019

Source Synthetic construct

Activity Information

Target Organism SARS-CoV-2

Assay Plaque reduction assay

Activity

[Ref.32843628]SARS-CoV-2:Inhibition of infection in Vero E6 cells(IC50=2.4 µg/ml);
SARS-CoV:Inhibition of infection in Vero E6 cells(IC50=6.2 µg/ml);
MERS-CoV:Inhibition of infection in Vero E6 cells(IC50=8.8 µg/ml);
Human rhinovirus (HRV):inhibition of infection in RD cells(IC50=34 µg/ml);
Human parainﬂuenza virus 3:Inhibition of infection in LLC-MK2 cells(IC50>25 µg/ml);
Human Influenza A Virus H1N1:Inhibition of infection In MDCK cells(IC50=1.6 µg/ml);
Human Influenza A Virus H7N9:Inhibition of infection In MDCK cells(IC50=3.3 µg/ml).
[Ref.26911565]Human Influenza A Virus H1N1(IC50=1.2 µg/ml);Human Influenza A Virus H3N2(IC50=1.2 µg/ml);Human Influenza A Virus H5N1(IC50=2.4 µg/ml);Human Influenza A Virus H7N7(IC50=0.8 µg/ml);Human Influenza A Virus H7N9(IC50=4.6 µg/ml);MERS-CoV(IC50=4.8 µg/ml);SARS-CoV(IC50=4.8 µg/ml)

Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity

[Ref.26911565]Cytotoxicity against Madin-Darby canine kidney cells(TC50=380 μg/ml).

Binding Target Not found

Mechanism Mechanistic studies show that positively charged P9 broadly inhibits viral replication by binding to different viruses and then inhibits virus–host endosomal acidification to prevent the endosomal release of pH-dependent viruses.

Structure Information

PDB ID 6M56

Predicted Structure Download No predicted structure available

Linear/Cyclic Linear

N-terminal Modification Free

C-terminal Modification Free

Other Modification None

Stereochemistry L

Physicochemical Information

Formula C144H227N47O35S5

Absent amino acids DELMSY

Common amino acids C

Mass 3336.98

Pl 9.41

Basic residues 6

Acidic residues 0

Hydrophobic residues 9

Net charge 6

Boman Index -4104

Hydrophobicity -6.67

Aliphatic Index 55.33

Half Life

Mammalian:1.4 hour
Yeast:3 min
E.coli:>10 hour

Extinction Coefficient cystines 5750

Absorbance 280nm 198.28

Polar residues 12

Literature Information

Literature 1

Title A novel peptide with potent and broad-spectrum antiviral activities against multiple respiratory viruses.

Pubmed ID 26911565

Reference Sci Rep. 2016 Feb 25;6:22008.

Author Zhao H, Zhou J, Zhang K, Chu H, Liu D, Poon VK, Chan CC, Leung HC, Fai N, Lin YP, Zhang AJ, Jin DY, Yuen KY, Zheng BJ.

DOI 10.1038/srep22008

Literature 2

Title A broad-spectrum virus- and host-targeting peptide against respiratory viruses including influenza virus and SARS-CoV-2.

Pubmed ID 32843628

Reference Nat Commun. 2020 Aug 25;11(1):4252.

Author Zhao H, To KKW, Sze KH, Yung TT, Bian M, Lam H, Yeung ML, Li C, Chu H, Yuen KY.

DOI 10.1038/s41467-020-17986-9