General Information


DRAVP ID  DRAVPe01762

Peptide Name   MBD-4 (11-40) (P9 [H21R,K23R,K28R], P9R)

Sequence  NGAICWGPCPTAFRQIGNCGRFRVRCCRIR

Sequence Length  30

UniProt ID  P82019 

Taxon ID  None

Source  Synthetic construct

Validation   Experimentally Validated



Origin Information


Gene Name/ID  Not Available

GenBank  Not Available

Amino Acid position  Not Available

Domain Accession ID  Not Available

Nucleotide sequence ID  Not Available

Molecular Type  Not Available

Chromosomal Position  Not Available



Activity Information


Target Organism  SARS-CoV-2

Assay  Plaque reduction assay

Activity 

  • [Ref.32843628]SARS-CoV-2:Inhibition of infection in Vero E6 cells(IC50=0.9 µg/ml);
  • SARS-CoV:Inhibition of infection in Vero E6 cells(IC50=4.2 µg/ml);
  • MERS-CoV:Inhibition of infection in Vero E6 cells(IC50=22 µg/ml);
  • Human rhinovirus (HRV):inhibition of infection in RD cells(IC50=5.7 µg/ml);
  • Human parainfluenza virus 3:Inhibition of infection in LLC-MK2 cells(IC50>25 µg/ml);
  • Human Influenza A Virus H1N1:Inhibition of infection In MDCK cells(IC50=0.6 µg/ml);
  • Human Influenza A Virus H7N9:Inhibition of infection In MDCK cells(IC50=0.9 µg/ml).

Hemolytic Activity 

  • [Ref.32843628]P9R did not cause the hemolysis of Chicken red blood cells.

Cytotoxicity 

  • [Ref.32843628]The CC50 of P9R was >300 μg/ml for MDCK, VeroE6 and A549 cells.

Binding Target  Not found

Mechanism  Mechanistic studies show that positively charged P9R broadly inhibits viral replication by binding to different viruses and then inhibits virus–host endosomal acidification to prevent the endosomal release of pH-dependent viruses.



Structure Information


PDB ID  6M56 

Predicted Structure Download  No predicted structure available

Linear/Cyclic  Linear

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Stereochemistry  L



Physicochemical Information


Formula  C144H232N52O35S5

Absent amino acids  DEHKLMSY

Common amino acids  R

Mass  3412.05

Pl  10.46

Basic residues  6

Acidic residues  0

Hydrophobic residues  9

Net charge  6

Boman Index  -7004

Hydrophobicity  -15

Aliphatic Index  55.33

Half Life 

  •     Mammalian:1.4 hour
  •     Yeast:3 min
  •     E.coli:>10 hour

Extinction Coefficient cystines  5750

Absorbance 280nm  198.28

Polar residues  12



Literature Information


Literature 1

Title   A broad-spectrum virus- and host-targeting peptide against respiratory viruses including influenza virus and SARS-CoV-2.

Pubmed ID   32843628

Reference   Nat Commun. 2020 Aug 25;11(1):4252.

Author   Zhao H, To KKW, Sze KH, Yung TT, Bian M, Lam H, Yeung ML, Li C, Chu H, Yuen KY.

DOI   10.1038/s41467-020-17986-9