General Information

General Information

DRAVP ID DRAVPe01762

Peptide Name MBD-4 (11-40) (P9 [H21R,K23R,K28R], P9R)

Sequence NGAICWGPCPTAFRQIGNCGRFRVRCCRIR

Sequence Length 30

UniProt ID P82019

Taxon ID None

Source Synthetic construct

Validation Experimentally Validated

Origin Information

Gene Name/ID Not Available

GenBank Not Available

Amino Acid position Not Available

Domain Accession ID Not Available

Nucleotide sequence ID Not Available

Molecular Type Not Available

Chromosomal Position Not Available

Activity Information

Target Organism SARS-CoV-2

Assay Plaque reduction assay

Activity

[Ref.32843628]SARS-CoV-2:Inhibition of infection in Vero E6 cells(IC50=0.9 µg/ml);
SARS-CoV:Inhibition of infection in Vero E6 cells(IC50=4.2 µg/ml);
MERS-CoV:Inhibition of infection in Vero E6 cells(IC50=22 µg/ml);
Human rhinovirus (HRV):inhibition of infection in RD cells(IC50=5.7 µg/ml);
Human parainﬂuenza virus 3:Inhibition of infection in LLC-MK2 cells(IC50>25 µg/ml);
Human Influenza A Virus H1N1:Inhibition of infection In MDCK cells(IC50=0.6 µg/ml);
Human Influenza A Virus H7N9:Inhibition of infection In MDCK cells(IC50=0.9 µg/ml).

Hemolytic Activity

[Ref.32843628]P9R did not cause the hemolysis of Chicken red blood cells.

Cytotoxicity

[Ref.32843628]The CC50 of P9R was >300 μg/ml for MDCK, VeroE6 and A549 cells.

Binding Target Not found

Mechanism Mechanistic studies show that positively charged P9R broadly inhibits viral replication by binding to different viruses and then inhibits virus–host endosomal acidification to prevent the endosomal release of pH-dependent viruses.

Structure Information

PDB ID 6M56

Predicted Structure Download No predicted structure available

Linear/Cyclic Linear

N-terminal Modification Free

C-terminal Modification Free

Other Modification None

Stereochemistry L

Physicochemical Information

Formula C144H232N52O35S5

Absent amino acids DEHKLMSY

Common amino acids R

Mass 3412.05

Pl 10.46

Basic residues 6

Acidic residues 0

Hydrophobic residues 9

Net charge 6

Boman Index -7004

Hydrophobicity -15

Aliphatic Index 55.33

Half Life

Mammalian:1.4 hour
Yeast:3 min
E.coli:>10 hour

Extinction Coefficient cystines 5750

Absorbance 280nm 198.28

Polar residues 12

Literature Information

Literature 1

Title A broad-spectrum virus- and host-targeting peptide against respiratory viruses including influenza virus and SARS-CoV-2.

Pubmed ID 32843628

Reference Nat Commun. 2020 Aug 25;11(1):4252.

Author Zhao H, To KKW, Sze KH, Yung TT, Bian M, Lam H, Yeung ML, Li C, Chu H, Yuen KY.

DOI 10.1038/s41467-020-17986-9