General Information


DRAVP ID  DRAVPe01763

Peptide Name   8P9R(branched P9R)

Sequence  NGAICWGPCPTAFRQIGNCGRFRVRCCRIR

Sequence Length  30

UniProt ID  No entry found

Taxon ID 

Source  Synthetic construct

Validation  



Origin Information


Gene Name/ID 

GenBank 

Amino Acid position 

Domain Accession ID 

Nucleotide sequence ID 

Molecular Type 

Chromosomal Position 



Activity Information


Target Organism  SARS-CoV-2

Assay  Plaque reduction assay

Activity 

  • [Ref.33750821]SARS-CoV-2:inhibition of replication in high salt condition(IC50 = 0.3 μg/ml)

Hemolytic Activity 

  • [Ref.33750821]No obvious hemolysis was observed when turkey red blood cells were treated at 200 μg/ml.

Cytotoxicity 

  • [Ref.33750821]Vero-E6 cells:the cytotoxicity indicated that TC50 of 8P9R was higher than 200 μg/ml.

Binding Target  Not found

Mechanism  Have dual-antiviral mechanisms of cross-linking viruses to stop viral entry (mediated by TMPRSS2 for SARS-CoV-2) and of reducing endosomal acidification to inhibit viral entry through endocytic pathway.



Structure Information


PDB ID  None

Predicted Structure Download  No predicted structure available

Linear/Cyclic  Branched

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Stereochemistry  L



Physicochemical Information


Formula  C144H232N52O35S5

Absent amino acids  DEHKLMSY

Common amino acids  R

Mass  3412.05

Pl  10.46

Basic residues  6

Acidic residues  0

Hydrophobic residues  9

Net charge  6

Boman Index  -7004

Hydrophobicity  -15

Aliphatic Index  55.33

Half Life 

  •     Mammalian:1.4 hour
  •     Yeast:3 min
  •     E.coli:>10 hour

Extinction Coefficient cystines  5750

Absorbance 280nm  198.28

Polar residues  12



Literature Information


Literature 1

Title   Cross-linking peptide and repurposed drugs inhibit both entry pathways of SARS-CoV-2.

Pubmed ID   33750821

Reference   Nat Commun. 2021 Mar 9;12(1):1517.

Author   Zhao H, To KKW, Lam H, Zhou X, Chan JF, Peng Z, Lee ACY, Cai J, Chan WM, Ip JD, Chan CC, Yeung ML, Zhang AJ, Chu AWH, Jiang S, Yuen KY.

DOI   10.1038/s41467-021-21825-w