General Information
DRAVP ID DRAVPe01763
Peptide Name 8P9R(branched P9R)
Sequence NGAICWGPCPTAFRQIGNCGRFRVRCCRIR
Sequence Length 30
UniProt ID No entry found
Taxon ID None
Source Synthetic construct
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not Available
Activity Information
Target Organism SARS-CoV-2
Assay Plaque reduction assay
Activity
Hemolytic Activity
Cytotoxicity
Binding Target Not found
Mechanism Have dual-antiviral mechanisms of cross-linking viruses to stop viral entry (mediated by TMPRSS2 for SARS-CoV-2) and of reducing endosomal acidification to inhibit viral entry through endocytic pathway.
Structure Information
PDB ID None
Predicted Structure Download No predicted structure available
Linear/Cyclic Branched
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C144H232N52O35S5
Absent amino acids DEHKLMSY
Common amino acids R
Mass 3412.05
Pl 10.46
Basic residues 6
Acidic residues 0
Hydrophobic residues 9
Net charge 6
Boman Index -7004
Hydrophobicity -15
Aliphatic Index 55.33
Half Life
Extinction Coefficient cystines 5750
Absorbance 280nm 198.28
Polar residues 12
Literature Information
Literature 1
Title Cross-linking peptide and repurposed drugs inhibit both entry pathways of SARS-CoV-2.
Pubmed ID 33750821
Reference Nat Commun. 2021 Mar 9;12(1):1517.
Author Zhao H, To KKW, Lam H, Zhou X, Chan JF, Peng Z, Lee ACY, Cai J, Chan WM, Ip JD, Chan CC, Yeung ML, Zhang AJ, Chu AWH, Jiang S, Yuen KY.