General Information

General Information

DRAVP ID DRAVPe01763

Peptide Name 8P9R(branched P9R)

Sequence NGAICWGPCPTAFRQIGNCGRFRVRCCRIR

Sequence Length 30

UniProt ID No entry found

Source Synthetic construct

Activity Information

Target Organism SARS-CoV-2

Assay Plaque reduction assay

Activity

[Ref.33750821]SARS-CoV-2:inhibition of replication in high salt condition(IC50 = 0.3 μg/ml)

Hemolytic Activity

[Ref.33750821]No obvious hemolysis was observed when turkey red blood cells were treated at 200 μg/ml.

Cytotoxicity

[Ref.33750821]Vero-E6 cells:the cytotoxicity indicated that TC50 of 8P9R was higher than 200 μg/ml.

Binding Target Not found

Mechanism Have dual-antiviral mechanisms of cross-linking viruses to stop viral entry (mediated by TMPRSS2 for SARS-CoV-2) and of reducing endosomal acidification to inhibit viral entry through endocytic pathway.

Structure Information

PDB ID None

Predicted Structure Download No predicted structure available

Linear/Cyclic Branched

N-terminal Modification Free

C-terminal Modification Free

Other Modification None

Stereochemistry L

Physicochemical Information

Formula C144H232N52O35S5

Absent amino acids DEHKLMSY

Common amino acids R

Mass 3412.05

Pl 10.46

Basic residues 6

Acidic residues 0

Hydrophobic residues 9

Net charge 6

Boman Index -7004

Hydrophobicity -15

Aliphatic Index 55.33

Half Life

Mammalian:1.4 hour
Yeast:3 min
E.coli:>10 hour

Extinction Coefficient cystines 5750

Absorbance 280nm 198.28

Polar residues 12

Literature Information

Literature 1

Title Cross-linking peptide and repurposed drugs inhibit both entry pathways of SARS-CoV-2.

Pubmed ID 33750821

Reference Nat Commun. 2021 Mar 9;12(1):1517.

Author Zhao H, To KKW, Lam H, Zhou X, Chan JF, Peng Z, Lee ACY, Cai J, Chan WM, Ip JD, Chan CC, Yeung ML, Zhang AJ, Chu AWH, Jiang S, Yuen KY.

DOI 10.1038/s41467-021-21825-w