General Information


DRAVP ID  DRAVPe01765

Peptide Name   MERS-CoV-HR2P-GSGSGC

Sequence  SLTQINTTLLDLTYEMLSLQQVVKALNESYIDLKELGSGSGC

Sequence Length  42

UniProt ID  R9UQ53,K9N5Q8 

Source  Synthetic construct



Activity Information


Target Organism  SARS-CoV-2

Assay  Cell-cell fusion assay,infectivity assay

Activity 

  • [Ref.33082259]SARS-CoV-2:ihibition of cell-cell fusion in 293T cells(IC50>650 nM,IC90>1000 nM),inhibition of infection in Vero E6 cells(IC50~ 36 nM);
  • SARS-CoV-2_D614G:ihibition of cell-cell fusion in 293T cells(IC50=1000 nM,IC90>1000 nM);
  • SARS-CoV-2_S943P:ihibition of cell-cell fusion in 293T cells(IC50>1000,IC90>1000 nM);
  • SARS-CoV-2_S247R:ihibition of cell-cell fusion in 293T cells(IC50>700 nM,IC90>1000 nM);
  • MERS-CoV:ihibition of cell-cell fusion in 293T cells(IC50=417±180 nM,IC90>1000 nM),inhibition of infection in Vero E6 cells(IC50~ 4 nM);
  • SARS-CoV-1:ihibition of cell-cell fusion in 293T cells(IC50=40±34 nM,IC90>700 nM).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity 

  • [Ref.33082259]Human embryonic kidney HEK293T cells:<10% Cytotoxicity at 10 µM;Vero E6 cells:12% Cytotoxicity at 10 µM.

Binding Target  membrane

Mechanism  The lipopeptide is derived from the C-terminal heptad repeat (HRC) domain of SARS-CoV-2 S that potently inhibits infection by SARS-CoV-2.



Structure Information


PDB ID  None

Predicted Structure Download  No predicted structure available

Linear/Cyclic  Linear

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Stereochemistry  L



Physicochemical Information


Formula  C200H331N49O69S2

Absent amino acids  FHPRW

Common amino acids  L

Mass  4590.23

Pl  4.18

Basic residues  2

Acidic residues  5

Hydrophobic residues  14

Net charge  -3

Boman Index  -3597

Hydrophobicity  10.48

Aliphatic Index  118.33

Half Life 

  •     Mammalian:1.9 hour
  •     Yeast:>20 hour
  •     E.coli:>10 hour

Extinction Coefficient cystines  2980

Absorbance 280nm  72.68

Polar residues  17



Literature Information


Literature 1

Title   Inhibition of Coronavirus Entry In Vitro and Ex Vivo by a Lipid-Conjugated Peptide Derived from the SARS-CoV-2 Spike Glycoprotein HRC Domain.

Pubmed ID   33082259

Reference   mBio. 2020 Oct 20;11(5):e01935-20.

Author   Outlaw VK, Bovier FT, Mears MC, Cajimat MN, Zhu Y, Lin MJ, Addetia A, Lieberman NAP, Peddu V, Xie X, Shi PY, Greninger AL, Gellman SH, Bente DA, Moscona A, Porotto M.

DOI   10.1128/mBio.01935-20