General Information
DRAVP ID DRAVPe01771
Peptide Name Covid_extented_1
Sequence RFDGKGLGIYQYMEEIEHAASRFAYFFYQHLA
Sequence Length 32
UniProt ID No entry found
Taxon ID None
Source Synthetic construct
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not Available
Activity Information
Target Organism SARS-CoV-2
Assay virus neutralization assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity No cytotoxicity information found in the reference(s) presented
Binding Target Not found
Mechanism The peptide acts as an inhibitor of the RBD–ACE2 interaction
Structure Information
PDB ID None
Predicted Structure Download No predicted structure available
Linear/Cyclic Linear
N-terminal Modification Acylation
C-terminal Modification Amidation
Other Modification None
Stereochemistry D
Physicochemical Information
Formula C181H253N45O48S
Absent amino acids CNPTVW
Common amino acids AFY
Mass 3859.33
Pl 6.03
Basic residues 5
Acidic residues 4
Hydrophobic residues 12
Net charge 1
Boman Index -4489
Hydrophobicity -33.13
Aliphatic Index 61.25
Half Life
Extinction Coefficient cystines 5960
Absorbance 280nm 192.26
Polar residues 8
Literature Information
Literature 1
Title Computational Design of Potent D-Peptide Inhibitors of SARS-CoV-2.
Pubmed ID 34624194
Reference J Med Chem. 2021 Oct 28;64(20):14955-14967.
Author Valiente PA, Wen H, Nim S, Lee J, Kim HJ, Kim J, Perez-Riba A, Paudel YP, Hwang I, Kim KD, Kim S, Kim PM.