General Information

General Information

DRAVP ID DRAVPe01771

Peptide Name Covid_extented_1

Sequence RFDGKGLGIYQYMEEIEHAASRFAYFFYQHLA

Sequence Length 32

UniProt ID No entry found

Source Synthetic construct

Activity Information

Target Organism SARS-CoV-2

Assay virus neutralization assay

Activity

[Ref.34624194]SARS-CoV-2:inhibition of infection in Vero cells(IC50=5.76 ± 1.65 μM);
SARS-CoV-2 variants B.1.1.7:inhibition of infection in Vero cells(IC50=5.57 ± 4.04 μM);
SARS-CoV-2 variants B.1.351:inhibition of infection in Vero cells(IC50=7.37 ± 1.80 μM).

Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity No cytotoxicity information found in the reference(s) presented

Binding Target Not found

Mechanism The peptide acts as an inhibitor of the RBD–ACE2 interaction

Structure Information

PDB ID None

Predicted Structure Download No predicted structure available

Linear/Cyclic Linear

N-terminal Modification Acylation

C-terminal Modification Amidation

Other Modification None

Stereochemistry D

Physicochemical Information

Formula C181H253N45O48S

Absent amino acids CNPTVW

Common amino acids AFY

Mass 3859.33

Pl 6.03

Basic residues 5

Acidic residues 4

Hydrophobic residues 12

Net charge 1

Boman Index -4489

Hydrophobicity -33.13

Aliphatic Index 61.25

Half Life

Mammalian:1 hour
Yeast:2 min
E.coli:2 min

Extinction Coefficient cystines 5960

Absorbance 280nm 192.26

Polar residues 8

Literature Information

Literature 1

Title Computational Design of Potent D-Peptide Inhibitors of SARS-CoV-2.

Pubmed ID 34624194

Reference J Med Chem. 2021 Oct 28;64(20):14955-14967.

Author Valiente PA, Wen H, Nim S, Lee J, Kim HJ, Kim J, Perez-Riba A, Paudel YP, Hwang I, Kim KD, Kim S, Kim PM.

DOI 10.1021/acs.jmedchem.1c00655