General Information

General Information

DRAVP ID DRAVPe01810

Peptide Name BmKDfsin3

Sequence GFGCPFNQGKCHRHCRSIRRRGGYCDGFLKQRCVCYRK

Sequence Length 38

UniProt ID A0A384E0Y8

Source Mesobuthus martensii Karsch

Activity Information

Target Organism HCV

Assay qPCR

Activity

[Ref.31963532]Hepatitis C virus (HCV): inhibition of viral replication in Huh7.5.1 cells(IC50=3.35±1.1 µM).

Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity

[Ref.31963532]Human hepatocellular carcinoma Huh-7.5.1 cells: CC50=60.63±1.36 µM.

Binding Target Not found

Mechanism BmKDfsin3 is revealed to enter into cells. Using an upstream MyD88 dimerization inhibitor ST2345 or kinase IRAK-1/4 inhibitor I, the inhibition of p38 activation represses HCV replication in vitro.

Structure Information

PDB ID 5XA6

Predicted Structure Download DRAVPe01810

Linear/Cyclic Cyclic

N-terminal Modification Free

C-terminal Modification Free

Other Modification Disulfide bonds between Cys4 and Cys25, Cys11 and Cys33, Cys15 and Cys35.

Stereochemistry L

Physicochemical Information

Formula C190H299N69O47S6

Absent amino acids AEMTW

Common amino acids R

Mass 4494.26

Pl 10

Basic residues 12

Acidic residues 1

Hydrophobic residues 6

Net charge 11

Boman Index -12439

Hydrophobicity -92.37

Aliphatic Index 28.16

Half Life

Mammalian:30 hour
Yeast:>20 hour
E.coli:>10 hour

Extinction Coefficient cystines 3355

Absorbance 280nm 90.68

Polar residues 16

Literature Information

Literature 1

Title Inhibitory Activity of a Scorpion Defensin BmKDfsin3 against Hepatitis C Virus.

Pubmed ID 31963532

Reference Antibiotics (Basel). 2020 Jan 17;9(1):33.

Author Cheng Y, Sun F, Li S, Gao M, Wang L, Sarhan M, Abdel-Rahman MA, Li W, Kwok HF, Wu Y, Cao Z.

DOI 10.3390/antibiotics9010033