General Information

General Information

DRAVP ID DRAVPe01812

Peptide Name Smp76

Sequence GWINEKKMQQKIDEKIGKNIIGGMAKAVIHKMAKNEFQCVANVDTLGNCKKHCAKTTGEKGYCHGTKCKCGIELSY

Sequence Length 76

UniProt ID No entry found

Source Scorpio maurus palmatu

Activity Information

Target Organism DENV

Assay Plaque assay

Activity

[Ref.32435168]Dengue Virus(DENV):inhibition of viral infection in Vero/SLAM cells(IC50= 0.01 μg/ml).

Hemolytic Activity

[Ref.32435168]human red blood cells:HC50>10 μg/ml.

Cytotoxicity

[Ref.32435168]Huh7it-1 cells:CC50>10 μg/ml.

Binding Target Not found

Mechanism No mechanism information found in the reference(s).

Structure Information

PDB ID None

Predicted Structure Download No predicted structure available

Linear/Cyclic Cyclic

N-terminal Modification Free

C-terminal Modification Free

Other Modification Disulfide bonds between Cys39 and Cys63, Cys49 and Cys68, Cys53 and Cys70.

Stereochemistry L

Physicochemical Information

Formula C362H595N105O106S9

Absent amino acids PR

Common amino acids K

Mass 8402.89

Pl 9.22

Basic residues 17

Acidic residues 7

Hydrophobic residues 19

Net charge 10

Boman Index -11300

Hydrophobicity -56.84

Aliphatic Index 64.21

Half Life

Mammalian:30 hour
Yeast:>20 hour
E.coli:>10 hour

Extinction Coefficient cystines 8855

Absorbance 280nm 118.07

Polar residues 27

Literature Information

Literature 1

Title Smp76, a Scorpine-Like Peptide Isolated from the Venom of the Scorpion Scorpio maurus palmatus, with a Potent Antiviral Activity Against Hepatitis C Virus and Dengue Virus.

Pubmed ID 32435168

Reference Int J Pept Res Ther. 2020;26(2):811-821.

Author El-Bitar AMH, Sarhan M, Abdel-Rahman MA, Quintero-Hernandez V, Aoki-Utsubo C, Moustafa MA, Possani LD, Hotta H.

DOI 10.1007/s10989-019-09888-2