To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
General Information
DRAVP ID DRAVPe01812
Peptide Name Smp76
Sequence GWINEKKMQQKIDEKIGKNIIGGMAKAVIHKMAKNEFQCVANVDTLGNCKKHCAKTTGEKGYCHGTKCKCGIELSY
Sequence Length 76
UniProt ID No entry found
Taxon ID None
Source Scorpio maurus palmatu
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not Available
Activity Information
Target Organism DENV
Assay Plaque assay
Activity
Hemolytic Activity
Cytotoxicity
Binding Target Not found
Mechanism No mechanism information found in the reference(s).
Structure Information
PDB ID None
Predicted Structure Download No predicted structure available
Linear/Cyclic Cyclic
N-terminal Modification Free
C-terminal Modification Free
Other Modification Disulfide bonds between Cys39 and Cys63, Cys49 and Cys68, Cys53 and Cys70.
Stereochemistry L
Physicochemical Information
Formula C362H595N105O106S9
Absent amino acids PR
Common amino acids K
Mass 8402.89
Pl 9.22
Basic residues 17
Acidic residues 7
Hydrophobic residues 19
Net charge 10
Boman Index -11300
Hydrophobicity -56.84
Aliphatic Index 64.21
Half Life
Extinction Coefficient cystines 8855
Absorbance 280nm 118.07
Polar residues 27
Literature Information
Literature 1
Title Smp76, a Scorpine-Like Peptide Isolated from the Venom of the Scorpion Scorpio maurus palmatus, with a Potent Antiviral Activity Against Hepatitis C Virus and Dengue Virus.
Pubmed ID 32435168
Reference Int J Pept Res Ther. 2020;26(2):811-821.
Author El-Bitar AMH, Sarhan M, Abdel-Rahman MA, Quintero-Hernandez V, Aoki-Utsubo C, Moustafa MA, Possani LD, Hotta H.
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.