General Information

General Information

DRAVP ID DRAVPe01813

Peptide Name BmKDfsin4

Sequence GFGCPFNQGQCHKHCQSIRRRGGYCDGFLKTRCVCYR

Sequence Length 37

UniProt ID No entry found

Source Mesobuthus martensii

Activity Information

Target Organism HBV

Assay ELISA

Activity

[Ref.27128943]hepatitic B Virus (HBV): Pharmacological profiles of BmKDfsin4 against HBeAg, HBsAg and HBV DNA on HepG2.2.15 cells(HBeAg: IC50= 3.95 μM; HBsAg: IC50= 2.28 μM; HBV DNA: IC50= 1.26 μM).

Hemolytic Activity

[Ref.27128943]Human erythrocytes: 50% hemolysis concentration was 66.85 μM.

Cytotoxicity

[Ref.27128943]HepG2.2.15 cells: CC50= 167.82 μM;
HepG2 cells: CC50= 154.24 μM;
L-02 cells: CC50= 103.77 μM.

Binding Target Not found

Mechanism BmKDfsin4 had been shown to exhibit powerful inhibitory activity against HBV replication by reducing the production of HBeAg, HBsAg, and HBV DNAin cell culture medium and the production of intracellular HBsAg, HBV core protein, HBx protein, and HBV RT.

Structure Information

PDB ID None

Predicted Structure Download No predicted structure available

Linear/Cyclic Cyclic

N-terminal Modification Free

C-terminal Modification Free

Other Modification Disulfide bonds between Cys4 and Cys25, Cys11 and Cys33, Cys15 and Cys35.

Stereochemistry L

Physicochemical Information

Formula C181H278N62O48S6

Absent amino acids AEMW

Common amino acids CG

Mass 4282.95

Pl 9.38

Basic residues 9

Acidic residues 1

Hydrophobic residues 6

Net charge 8

Boman Index -9711

Hydrophobicity -71.35

Aliphatic Index 28.92

Half Life

Mammalian:30 hour
Yeast:>20 hour
E.coli:>10 hour

Extinction Coefficient cystines 3355

Absorbance 280nm 93.19

Polar residues 17

Literature Information

Literature 1

Title A Scorpion Defensin BmKDfsin4 Inhibits Hepatitis B Virus Replication in Vitro.

Pubmed ID 27128943

Reference Toxins (Basel). 2016 Apr 27;8(5):124.

Author Zeng Z, Zhang Q, Hong W, Xie Y, Liu Y, Li W, Wu Y, Cao Z.

DOI 10.3390/toxins8050124