General Information


DRAVP ID  DRAVPe01813

Peptide Name   BmKDfsin4

Sequence  GFGCPFNQGQCHKHCQSIRRRGGYCDGFLKTRCVCYR

Sequence Length  37

UniProt ID  No entry found

Taxon ID  None

Source  Mesobuthus martensii

Validation   Experimentally Validated



Origin Information


Gene Name/ID  Not Available

GenBank  Not Available

Amino Acid position  Not Available

Domain Accession ID  Not Available

Nucleotide sequence ID  Not Available

Molecular Type  Not Available

Chromosomal Position  Not Available



Activity Information


Target Organism  HBV

Assay  ELISA

Activity 

  • [Ref.27128943]hepatitic B Virus (HBV): Pharmacological profiles of BmKDfsin4 against HBeAg, HBsAg and HBV DNA on HepG2.2.15 cells(HBeAg: IC50= 3.95 μM; HBsAg: IC50= 2.28 μM; HBV DNA: IC50= 1.26 μM).

Hemolytic Activity 

  • [Ref.27128943]Human erythrocytes: 50% hemolysis concentration was 66.85 μM.

Cytotoxicity 

  • [Ref.27128943]HepG2.2.15 cells: CC50= 167.82 μM;
  • HepG2 cells: CC50= 154.24 μM;
  • L-02 cells: CC50= 103.77 μM.

Binding Target  Not found

Mechanism  BmKDfsin4 had been shown to exhibit powerful inhibitory activity against HBV replication by reducing the production of HBeAg, HBsAg, and HBV DNAin cell culture medium and the production of intracellular HBsAg, HBV core protein, HBx protein, and HBV RT.



Structure Information


PDB ID  None

Predicted Structure Download  No predicted structure available

Linear/Cyclic  Cyclic

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  Disulfide bonds between Cys4 and Cys25, Cys11 and Cys33, Cys15 and Cys35.

Stereochemistry  L



Physicochemical Information


Formula  C181H278N62O48S6

Absent amino acids  AEMW

Common amino acids  CG

Mass  4282.95

Pl  9.38

Basic residues  9

Acidic residues  1

Hydrophobic residues  6

Net charge  8

Boman Index  -9711

Hydrophobicity  -71.35

Aliphatic Index  28.92

Half Life 

  •     Mammalian:30 hour
  •     Yeast:>20 hour
  •     E.coli:>10 hour

Extinction Coefficient cystines  3355

Absorbance 280nm  93.19

Polar residues  17



Literature Information


Literature 1

Title   A Scorpion Defensin BmKDfsin4 Inhibits Hepatitis B Virus Replication in Vitro.

Pubmed ID   27128943

Reference   Toxins (Basel). 2016 Apr 27;8(5):124.

Author   Zeng Z, Zhang Q, Hong W, Xie Y, Liu Y, Li W, Wu Y, Cao Z.

DOI   10.3390/toxins8050124