General Information

General Information

DRAVP ID DRAVPe01883

Peptide Name HLFcin 1-49

Sequence GRRRRSVQWCAVSQPEATKCFQWQRNMRKVRGPPVSCIKRDSPIQCIQA

Sequence Length 49

UniProt ID No entry found

Source Synthetic construct

Activity Information

Target Organism HPV

Assay Western blotting

Activity

[Ref.17481742]human papillomavirus(HPV):inhibition of pseudovirus infection in C33A cells(IC50=0.32±0.18μM).

Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity

No cytotoxicity information or data found in the reference(s) presented in this entry

Binding Target Not found

Mechanism No mechanism information found in the reference(s).

Structure Information

PDB ID None

Predicted Structure Download No predicted structure available

Linear/Cyclic Cyclic

N-terminal Modification Free

C-terminal Modification Free

Other Modification Disulfide bonds between Cys10 and Cys46, Cys20 and Cys37.

Stereochemistry L

Physicochemical Information

Formula C244H403N85O66S5

Absent amino acids HLY

Common amino acids R

Mass 5743.71

Pl 11.24

Basic residues 11

Acidic residues 2

Hydrophobic residues 13

Net charge 9

Boman Index -15425

Hydrophobicity -85.1

Aliphatic Index 53.67

Half Life

Mammalian:30 hour
Yeast:>20 hour
E.coli:>10 hour

Extinction Coefficient cystines 11250

Absorbance 280nm 234.38

Polar residues 12

Literature Information

Literature 1

Title The anti-papillomavirus activity of human and bovine lactoferricin.

Pubmed ID 17481742

Reference Antiviral Res. 2007 Sep;75(3):258-65.

Author Mistry N, Drobni P, Näslund J, Sunkari VG, Jenssen H, Evander M.

DOI 10.1016/j.antiviral.2007.03.012