To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
General Information
DRAVP ID DRAVPe01888
Peptide Name HR1-30a
Sequence AVSKVLHLEGEVNKISALLSTNKAVVSLSNGVSVLTSKVLDLDNYIDKQLLPIVNK
Sequence Length 56
UniProt ID No entry found
Source Synthetic construct
Activity Information
Target Organism RSV
Assay Cell fusion assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity
Binding Target F protein
Mechanism Peptide derived from hRSV F protein give strong virus–cell fusion inhibition effect.
Structure Information
PDB ID None
Predicted Structure Download No predicted structure available
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C268H458N70O83
Absent amino acids CFMRW
Common amino acids LV
Mass 5989
Pl 8.35
Basic residues 7
Acidic residues 5
Hydrophobic residues 25
Net charge 2
Boman Index -3793
Hydrophobicity 33.75
Aliphatic Index 142.5
Half Life
Extinction Coefficient cystines 1490
Absorbance 280nm 27.09
Polar residues 17
Literature Information
Literature 1
Title Both heptad repeats of human respiratory syncytial virus fusion protein are potent inhibitors of viral fusion.
Pubmed ID 12615056
Reference Biochem Biophys Res Commun. 2003 Mar 14;302(3):469-75.
Author Wang E, Sun X, Qian Y, Zhao L, Tien P, Gao GF.
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.