DRAVP ID  DRAVPe01888

Peptide Name   HR1-30a

Sequence  AVSKVLHLEGEVNKISALLSTNKAVVSLSNGVSVLTSKVLDLDNYIDKQLLPIVNK

Sequence Length  56

UniProt ID  No entry found

Taxon ID  None

Source  Synthetic construct

Validation   Experimentally Validated

Gene Name/ID  Not Available

GenBank  Not Available

Amino Acid position  Not Available

Domain Accession ID  Not Available

Nucleotide sequence ID  Not Available

Molecular Type  Not Available

Chromosomal Position  Not Available

Target Organism  RSV

Assay  Cell fusion assay

Activity 

• [Ref.12615056]respiratory syncytial virus(RSV):inhibition of cell fusion in Hep2 cells( IC50=1.68 μM).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity 

• No cytotoxicity information or data found in the reference(s) presented in this entry

Binding Target  F protein

Mechanism  Peptide derived from hRSV F protein give strong virus–cell fusion inhibition effect.

PDB ID  None

Predicted Structure Download  No predicted structure available

Linear/Cyclic  Linear

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Stereochemistry  L

Literature 1

Title   Both heptad repeats of human respiratory syncytial virus fusion protein are potent inhibitors of viral fusion.

Pubmed ID   12615056

Reference   Biochem Biophys Res Commun. 2003 Mar 14;302(3):469-75.

Author   Wang E, Sun X, Qian Y, Zhao L, Tien P, Gao GF.

DOI   10.1016/s0006-291x(03)00197-9