To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
General Information
DRAVP ID DRAVPe01889
Peptide Name HR2-30a
Sequence NFYDPLVFPSDEFDASISQVNEKINQSLASIRKSDELLHNVNAGK
Sequence Length 45
UniProt ID No entry found
Source Synthetic construct
Activity Information
Target Organism RSV
Assay Cell fusion assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity
Binding Target F protein
Mechanism Peptide derived from hRSV F protein give strong virus–cell fusion inhibition effect.
Structure Information
PDB ID None
Predicted Structure Download No predicted structure available
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C223H346N60O74
Absent amino acids CMTW
Common amino acids S
Mass 5051.56
Pl 4.65
Basic residues 5
Acidic residues 7
Hydrophobic residues 16
Net charge -2
Boman Index -9449
Hydrophobicity -51.11
Aliphatic Index 86.67
Half Life
Extinction Coefficient cystines 1490
Absorbance 280nm 33.86
Polar residues 13
Literature Information
Literature 1
Title Both heptad repeats of human respiratory syncytial virus fusion protein are potent inhibitors of viral fusion.
Pubmed ID 12615056
Reference Biochem Biophys Res Commun. 2003 Mar 14;302(3):469-75.
Author Wang E, Sun X, Qian Y, Zhao L, Tien P, Gao GF.
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.