General Information
DRAVP ID DRAVPe01894
Peptide Name MLH40
Sequence SVALVPHVGMGLETRTETWMSSEGAWKHVQRIETWILRHPG
Sequence Length 41
UniProt ID No entry found
Taxon ID None
Source Synthetic construct
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not Available
Activity Information
Target Organism DENV
Assay cell-based flavivirus immunodetection assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity
Binding Target Not found
Mechanism No mechanism information found in the reference(s).
Structure Information
PDB ID None
Predicted Structure Download No predicted structure available
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C209H325N61O58S2
Absent amino acids CDFNY
Common amino acids EGTV
Mass 4684.37
Pl 6.79
Basic residues 7
Acidic residues 4
Hydrophobic residues 14
Net charge 3
Boman Index -5772
Hydrophobicity -30.73
Aliphatic Index 80.73
Half Life
Extinction Coefficient cystines 16500
Absorbance 280nm 412.5
Polar residues 11
Literature Information
Literature 1
Title A peptide inhibitor derived from the conserved ectodomain region of DENV membrane (M) protein with activity against dengue virus infection.
Pubmed ID 25891143
Reference Chem Biol Drug Des. 2015 Nov;86(5):1093-104.
Author Panya A, Sawasdee N, Junking M, Srisawat C, Choowongkomon K, Yenchitsomanus PT.