General Information

General Information

DRAVP ID DRAVPe01894

Peptide Name MLH40

Sequence SVALVPHVGMGLETRTETWMSSEGAWKHVQRIETWILRHPG

Sequence Length 41

UniProt ID No entry found

Source Synthetic construct

Activity Information

Target Organism DENV

Assay cell-based flavivirus immunodetection assay

Activity

[Ref.25891143]dengue virus 1(DENV1):inhibition of viral infection in Vero cells(IC50=30.35 ± 1.25 μM);
dengue virus 2(DENV2):inhibition of viral infection in Vero cells(IC50=31.41 ± 1.09 μM);
dengue virus 3(DENV3):inhibition of viral infection in Vero cells(IC50=27.95 ± 1.41 μM);
dengue virus 4(DENV4):inhibition of viral infection in Vero cells(IC50=24.45 ± 1.20 μM).

Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity

No cytotoxicity information or data found in the reference(s) presented in this entry

Binding Target Not found

Mechanism No mechanism information found in the reference(s).

Structure Information

PDB ID None

Predicted Structure Download No predicted structure available

Linear/Cyclic Linear

N-terminal Modification Free

C-terminal Modification Free

Other Modification None

Stereochemistry L

Physicochemical Information

Formula C209H325N61O58S2

Absent amino acids CDFNY

Common amino acids EGTV

Mass 4684.37

Pl 6.79

Basic residues 7

Acidic residues 4

Hydrophobic residues 14

Net charge 3

Boman Index -5772

Hydrophobicity -30.73

Aliphatic Index 80.73

Half Life

Mammalian:1.9 hour
Yeast:>20 hour
E.coli:>10 hour

Extinction Coefficient cystines 16500

Absorbance 280nm 412.5

Polar residues 11

Literature Information

Literature 1

Title A peptide inhibitor derived from the conserved ectodomain region of DENV membrane (M) protein with activity against dengue virus infection.

Pubmed ID 25891143

Reference Chem Biol Drug Des. 2015 Nov;86(5):1093-104.

Author Panya A, Sawasdee N, Junking M, Srisawat C, Choowongkomon K, Yenchitsomanus PT.

DOI 10.1111/cbdd.12576