General Information


DRAVP ID  DRAVPe01944

Peptide Name   HRB6

Sequence  PEDQFNVALDQVFESIENSQALVDQSNRILSSAEKGNTG

Sequence Length  39

UniProt ID  No entry found

Source  Synthetic construct



Activity Information


Target Organism  HMPV

Assay  RT-PCR assay

Activity 

  • [Ref.17967906]Human Metapneumovirus(hMPV):inhibition of viral infection in LLC-MK2 cells(IC50=3310 nM).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity 

  • [Ref.17967906]No cytotoxicity against LLC-MK2 cells at the highest concentrations tested (9 μM).

Binding Target  F protein

Mechanism  In hMPV, the F proteins assemble as trimers inside which three HRA (as well as three HRB) are creating a coiled coil. Then, the two pairs of coiled-coils (HRA and HRB) interact, creating a six-helix bundle structure that brings the viral and the cellular membranes close together, causing membrane merge and fusion pore dilatation. Peptide designed based in the HRA and HRB domains of the F protein can inhibit the process.



Structure Information


PDB ID  None

Predicted Structure Download  No predicted structure available

Linear/Cyclic  Linear

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Stereochemistry  L



Physicochemical Information


Formula  C180H285N51O68

Absent amino acids  CHMWY

Common amino acids  S

Mass  4251.54

Pl  3.95

Basic residues  2

Acidic residues  7

Hydrophobic residues  13

Net charge  -5

Boman Index  -9217

Hydrophobicity  -61.54

Aliphatic Index  80

Half Life 

  •     Mammalian:>20 hour
  •     Yeast:>20 hour
  •     E.coli:?

Extinction Coefficient cystines  0

Absorbance 280nm  0

Polar residues  12



Literature Information


Literature 1

Title   Identification and evaluation of a highly effective fusion inhibitor for human metapneumovirus.

Pubmed ID   17967906

Reference   Antimicrob Agents Chemother. 2008 Jan;52(1):279-87.

Author   Deffrasnes C, Hamelin ME, Prince GA, Boivin G.

DOI   10.1128/AAC.00793-07