General Information
DRAVP ID DRAVPe01944
Peptide Name HRB6
Sequence PEDQFNVALDQVFESIENSQALVDQSNRILSSAEKGNTG
Sequence Length 39
UniProt ID No entry found
Taxon ID None
Source Synthetic construct
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not Available
Activity Information
Target Organism HMPV
Assay RT-PCR assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity
Binding Target F protein
Mechanism In hMPV, the F proteins assemble as trimers inside which three HRA (as well as three HRB) are creating a coiled coil. Then, the two pairs of coiled-coils (HRA and HRB) interact, creating a six-helix bundle structure that brings the viral and the cellular membranes close together, causing membrane merge and fusion pore dilatation. Peptide designed based in the HRA and HRB domains of the F protein can inhibit the process.
Structure Information
PDB ID None
Predicted Structure Download No predicted structure available
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C180H285N51O68
Absent amino acids CHMWY
Common amino acids S
Mass 4251.54
Pl 3.95
Basic residues 2
Acidic residues 7
Hydrophobic residues 13
Net charge -5
Boman Index -9217
Hydrophobicity -61.54
Aliphatic Index 80
Half Life
Extinction Coefficient cystines 0
Absorbance 280nm 0
Polar residues 12
Literature Information
Literature 1
Title Identification and evaluation of a highly effective fusion inhibitor for human metapneumovirus.
Pubmed ID 17967906
Reference Antimicrob Agents Chemother. 2008 Jan;52(1):279-87.
Author Deffrasnes C, Hamelin ME, Prince GA, Boivin G.