General Information


DRAVP ID  DRAVPe01946

Peptide Name   TP2

Sequence  MVALGDTAWDFGSVGGVLTSIGKGIHQVFGSAFKSL

Sequence Length  36

UniProt ID  No entry found

Taxon ID  64293 

Source  Synthetic construct

Validation   Experimentally Validated



Origin Information


Gene Name/ID  10971339

GenBank  JF895923.2

Amino Acid position  Not Available

Domain Accession ID  TIGR04240 

Nucleotide sequence ID  JF895923 

Molecular Type  Genomic RNA

Chromosomal Position  Not available



Activity Information


Target Organism  TMUV

Assay  Plaque assay, Western blotting

Activity 

  • [Ref.32456819]Tembusu virus (TMUV):inhibition of viral infection in BHK-21 cells(IC50=7.64 mg/L).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity 

  • [Ref.32456819]No cytotoxicity against BHK-21 cells up to 150mg / L.

Binding Target  Not found

Mechanism  TP2 might be an interference factor between TMUV and the cell.



Structure Information


PDB ID  None

Predicted Structure Download  No predicted structure available

Linear/Cyclic  Linear

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Stereochemistry  L



Physicochemical Information


Formula  C167H258N42O48S

Absent amino acids  CENPRY

Common amino acids  G

Mass  3654.2

Pl  6.5

Basic residues  3

Acidic residues  2

Hydrophobic residues  16

Net charge  1

Boman Index  891

Hydrophobicity  64.17

Aliphatic Index  94.72

Half Life 

  •     Mammalian:30 hour
  •     Yeast:>20 hour
  •     E.coli:>10 hour

Extinction Coefficient cystines  5500

Absorbance 280nm  157.14

Polar residues  13



Literature Information


Literature 1

Title   Peptide inhibitors of tembusu virus infection derived from the envelope protein. 

Pubmed ID   32456819

Reference   Vet Microbiol. 2020 Jun;245:108708.

Author   Zhao D, Zhang L, Han K, Liu Q, Yang J, Huang X, Liu Y, Li Y, Zhao P.

DOI   10.1016/j.vetmic.2020.108708