To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
General Information
DRAVP ID DRAVPe01946
Peptide Name TP2
Sequence MVALGDTAWDFGSVGGVLTSIGKGIHQVFGSAFKSL
Sequence Length 36
UniProt ID No entry found
Taxon ID 64293
Source Synthetic construct
Validation Experimentally Validated
Origin Information
Gene Name/ID 10971339
GenBank JF895923.2
Amino Acid position Not Available
Domain Accession ID TIGR04240
Nucleotide sequence ID JF895923
Molecular Type Genomic RNA
Chromosomal Position Not available
Activity Information
Target Organism TMUV
Assay Plaque assay, Western blotting
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity
Binding Target Not found
Mechanism TP2 might be an interference factor between TMUV and the cell.
Structure Information
PDB ID None
Predicted Structure Download No predicted structure available
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C167H258N42O48S
Absent amino acids CENPRY
Common amino acids G
Mass 3654.2
Pl 6.5
Basic residues 3
Acidic residues 2
Hydrophobic residues 16
Net charge 1
Boman Index 891
Hydrophobicity 64.17
Aliphatic Index 94.72
Half Life
Extinction Coefficient cystines 5500
Absorbance 280nm 157.14
Polar residues 13
Literature Information
Literature 1
Title Peptide inhibitors of tembusu virus infection derived from the envelope protein.
Pubmed ID 32456819
Reference Vet Microbiol. 2020 Jun;245:108708.
Author Zhao D, Zhang L, Han K, Liu Q, Yang J, Huang X, Liu Y, Li Y, Zhao P.
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.