DRAVP ID  DRAVPe01958

Peptide Name   Beta-defensin 2(BD-2, hBD-2, SAP1)

Sequence  GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP

Sequence Length  41

UniProt ID  O15263 

Source  Homo sapiens

Target Organism  HIV

Assay  ELISA

Activity 

• [Ref.16254366]HIV-1 BaL:inhibition of viral infection in TZM-bl cells(80% Inhibition at 100 µg/ml, 68% Inhibition at 50 µg/ml, 55% Inhibition at 25 µg/ml, 45% Inhibition at 12.5 µg/ml, 32% Inhibition at 6.2 µg/ml, 28% Inhibition at 3.1 µg/ml, 18% Inhibition at 1.6 µg/ml, 20% Inhibition at 0.8 µg/ml,);
• HIV-1 IIIB:inhibition of viral infection in TZM-bl cells(95% Inhibition at 100 µg/ml, 87% Inhibition at 50 µg/ml, 75% Inhibition at 25 µg/ml, 62% Inhibition at 12.5 µg/ml, 55% Inhibition at 6.2 µg/ml, 35% Inhibition at 3.1 µg/ml, 28% Inhibition at 1.6 µg/ml, 25% Inhibition at 0.8 µg/ml,).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity 

• No cytotoxicity information or data found in the reference(s) presented in this entry

Binding Target  Not found

Mechanism  No mechanism information found in the reference(s).

PDB ID  1FD4 

Predicted Structure Download  DRAVPe01958

Linear/Cyclic  Cyclic

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  Disulfide bonds between Cys8 and Cys37, Cys15 and Cys30, Cys20 and Cys38.

Stereochemistry  L

Literature 1

Title   Human beta-defensins suppress human immunodeficiency virus infection: potential role in mucosal protection. 

Pubmed ID   16254366

Reference   J Virol. 2005 Nov;79(22):14318-29. 

Author   Sun L, Finnegan CM, Kish-Catalone T, Blumenthal R, Garzino-Demo P, La Terra Maggiore GM, Berrone S, Kleinman C, Wu Z, Abdelwahab S, Lu W, Garzino-Demo A.

DOI   10.1128/JVI.79.22.14318-14329.2005