General Information


DRAVP ID  DRAVPe01959

Peptide Name   Cicadin

Sequence  NEYHGFVDKANNENKRKKQQGRDDFVVKPNNFANRRRKDDYNENYYDDVDAADVV

Sequence Length  55

UniProt ID  P83282 

Source  Cicada flammata



Activity Information


Target Organism  HIV

Assay  ELISA

Activity 

  • [Ref.11814612]HIV-1:inhibition the activity of reverse transcriptase(11.35±1.8% Inhibition at 0.1 µM, 85.8±2.3% Inhibition at 1 µM).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity 

  • No cytotoxicity information or data found in the reference(s) presented in this entry

Binding Target  Not found

Mechanism  No mechanism information found in the reference(s).



Structure Information


PDB ID  None

Predicted Structure Download  No predicted structure available

Linear/Cyclic  Linear

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Stereochemistry  L



Physicochemical Information


Formula  C283H427N89O95

Absent amino acids  CILMSTW

Common amino acids  DN

Mass  6596.04

Pl  5.7

Basic residues  12

Acidic residues  12

Hydrophobic residues  13

Net charge  0

Boman Index  -24057

Hydrophobicity  -175.27

Aliphatic Index  38.91

Half Life 

  •     Mammalian:1.4 hour
  •     Yeast:3 min
  •     E.coli:>10 hour

Extinction Coefficient cystines  5960

Absorbance 280nm  110.37

Polar residues  15



Literature Information


Literature 1

Title   Isolation of cicadin, a novel and potent antifungal peptide from dried juvenile cicadas.

Pubmed ID   11814612

Reference   Peptides. 2002 Jan;23(1):7-11. 

Author   Wang H, Ng TB.

DOI   10.1016/s0196-9781(01)00573-3