To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
General Information
DRAVP ID DRAVPe01973
Peptide Name CHR-1, Env GP (623-658)
Sequence WNHTTWMEWDREINNYTSLIHSLIEESQNQQEKNEQ
Sequence Length 36
UniProt ID P04578
Source Synthetic construct
Activity Information
Target Organism HIV
Assay ELISA
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity
Binding Target cell membrane
Mechanism The peptide can interact with the viral NHR to form stable heterologous 6-HBs, resulting in inhibition of fusion between the viral and target cell membranes.
Structure Information
PDB ID None
Predicted Structure Download No predicted structure available
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C196H288N56O67S
Absent amino acids ACFGPV
Common amino acids E
Mass 4532.84
Pl 4.53
Basic residues 4
Acidic residues 7
Hydrophobic residues 8
Net charge -3
Boman Index -11884
Hydrophobicity -156.39
Aliphatic Index 54.17
Half Life
Extinction Coefficient cystines 17990
Absorbance 280nm 514
Polar residues 12
Literature Information
Literature 1
Title HIV gp41 C-terminal heptad repeat contains multifunctional domains. Relation to mechanisms of action of anti-HIV peptides
Pubmed ID 17276993
Reference J Biol Chem. 2007 Mar 30;282(13):9612-9620.
Author Liu S, Jing W, Cheung B, Lu H, Sun J, Yan X, Niu J, Farmar J, Wu S, Jiang S.
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.