DRAVP ID  DRAVPe01974

Peptide Name   C36, Env GP (628-663)

Sequence  WMEWDREINNYTSLIHSLIEESQNQQEKNEQELLEL

Sequence Length  36

UniProt ID  P04578 

Taxon ID  None

Source  Synthetic construct

Other Link  DRAVPa0917

Validation   Experimentally Validated

Gene Name/ID  Not Available

GenBank  Not Available

Amino Acid position  Not Available

Domain Accession ID  Not Available

Nucleotide sequence ID  Not Available

Molecular Type  Not Available

Chromosomal Position  Not Available

Target Organism  HIV

Assay  ELISA

Activity 

• [Ref.17276993]human immunodeficiency virus (HIV):inhibition of cell-cell fusion in MT-2 cells(IC50=4.67 ± 0.07 nM; IC90=7.04 ± 0.12 nM).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity 

• No cytotoxicity information or data found in the reference(s) presented in this entry

Binding Target  cell membrane

Mechanism  The peptide can interact with the viral NHR to form stable heterologous 6-HBs, resulting in inhibition of fusion between the viral and target cell membranes.

PDB ID  None

Predicted Structure Download  No predicted structure available

Linear/Cyclic  Linear

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Stereochemistry  L

Literature 1

Title   HIV gp41 C-terminal heptad repeat contains multifunctional domains. Relation to mechanisms of action of anti-HIV peptides

Pubmed ID   17276993

Reference   J Biol Chem. 2007 Mar 30;282(13):9612-9620.

Author   Liu S, Jing W, Cheung B, Lu H, Sun J, Yan X, Niu J, Farmar J, Wu S, Jiang S.

DOI   10.1074/jbc.M609148200