To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
General Information
DRAVP ID DRAVPe02093
Peptide Name 4H30
Sequence GAICHPVFCPRRYKQIGTCGLPGTKCCKKP
Sequence Length 30
UniProt ID O15263
Taxon ID 9606
Source human beta-defensin 2 (HBD2)
Other Link DRAVPa2313
Validation Experimentally Validated
Origin Information
Gene Name/ID DEFB4A(100289462)
GenBank AF040153.1
Amino Acid position 20-64
Domain Accession ID pfam00711
Nucleotide sequence ID CM000670.2
Molecular Type mRNA
Chromosomal Position Chromosome 8:7,894,677-7,896,716
Activity Information
Target Organism SARS-CoV-2
Assay plaque reduction assay/
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity
Binding Target Lipid Bilayer
Mechanism 4H30 can inhibit three distinct steps of the SARS-CoV-2 life cycle. Specifically, 4H30 blocks viral entry by clustering SARS-CoV-2 virions; prevents membrane fusion by inhibiting endosomal acidification; and inhibits the release of virions by cross-linking SARS-CoV-2 with cellular glycosaminoglycans.
Structure Information
PDB ID 1FD3
Predicted Structure Download No predicted structure available
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C87H157N23O24S2
Absent amino acids ARNDQEHIMFPTWYOU
Common amino acids GLV
Mass 1973.46
Pl 8.9
Basic residues 7
Acidic residues 0
Hydrophobic residues 11
Net charge 7
Boman Index 1.12
Hydrophobicity -1.36
Aliphatic Index 152.86
Half Life
Extinction Coefficient cystines 125
Absorbance 280nm 0.063
Polar residues 8
Literature Information
Literature 1
Title A trifunctional peptide broadly inhibits SARS-CoV-2 Delta and Omicron variants in hamsters
Pubmed ID 35768416
Reference Cell Discov. 2022 Jun 30;8(1):62
Author Zhao H, To KK, Lam H, Zhang C, Peng Z, Meng X, Wang X, Zhang AJ, Yan B, Cai J, Yeung ML, Chan JF, Yuen KY
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.