To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
DRAVP ID DRAVPa0873
Peptide Name Sequence 3 from Patent US 7575750 B2
Sequence WQEWEQKITALLEQAQIQQEKNEYELQKLDKWASLWEWF
Sequence Length 39
Source Synthetic construct
Target Organism HIV, SIV
Patent Type Granted Patent
Publication Date 2009-08-18
Patent No US 7575750 B2
Family Info WO 2004/029201 A2, CA 2500248 A1, AU 2003/275116 A1, WO 2004/029201 A3, US 2005/0089840 A1, EP 1542718 A2, AP 2005003291 A0, BR 0314657 A, CN 1668330 A, EA 200500533 A1, JP 2006505536 A, ZA 200503118
Patent Title Human immunodeficiency virus (HIV) gp41 peptide derivatives with enhanced solubility and antiviral activity
Comment The peptide was modified with acetyl N-terminus and amide C-terminus, which exihibits antiviral activity by inhibiting viral infection of cells, for example, by inhibiting cell-cell fusion or free virus infection.
Abstract This invention relates to gp41 peptide derivatives that are inhibitors of viral infection and/or exhibit antifusogenic properties. In particular, this invention relates to gp41 derivatives having inhibiting activity against human immunodeficiency virus (HIV) and simian immunodeficiency virus (SIV) with enhanced duration of action for the treatment of the respective viral infections.
Other Link DRAVPe00254
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.