General Information

General Information

DRAVP ID DRAVPe00254

Peptide Name 1249

Sequence WQEWEQKITALLEQAQIQQEKNEYELQKLDKWASLWEWF

Sequence Length 39

UniProt ID No entry found

Source Synthetic construct

Other Link DRAVPa0873

Activity Information

Target Organism HIV

Assay MAGI/cMAGI infectivity assay

Activity

[Ref.17640899]HIV IIIB:inhibition of virus infection on CEM4 cells(IC50=0.003 μg/ml);
HIV 098:inhibition of virus infection on CEM4 cells(IC50=0.013 μg/ml);
HIV 098-T20:inhibition of virus infection on CEM4 cells(IC50=0.022 μg/ml);
HIV 098-T1249:inhibition of virus infection on CEM4 cells(IC50=0.363 μg/ml);
HIV 098-T651:inhibition of virus infection on CEM4 cells(IC50=8.140 μg/ml).

Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity

No cytotoxicity information or data found in the reference(s) presented in this entry

Binding Target membrane

Mechanism The peptide acts by binding to the heptad repeat 1 (HR1) region of gp41 and preventing the interaction of the HR1 and HR2 domains, which is required for virus–cell fusion.

Structure Information

PDB ID None

Predicted Structure Download No predicted structure available

Linear/Cyclic Linear

N-terminal Modification Acetylation

C-terminal Modification Amidation

Other Modification None

Stereochemistry L

Physicochemical Information

Formula C233H338N56O67

Absent amino acids CGHMPRV

Common amino acids EQ

Mass 4995.58

Pl 4.43

Basic residues 4

Acidic residues 8

Hydrophobic residues 16

Net charge -4

Boman Index -7562

Hydrophobicity -109.49

Aliphatic Index 77.69

Half Life

Mammalian:2.8 hour
Yeast:3 min
E.coli:2 min

Extinction Coefficient cystines 28990

Absorbance 280nm 762.89

Polar residues 4

Literature Information

Literature 1

Title Design of helical, oligomeric HIV-1 fusion inhibitor peptides with potent activity against enfuvirtide-resistant virus.

Pubmed ID 17640899

Reference Proc Natl Acad Sci U S A. 2007 Jul 31;104(31):12772-7.

Author Dwyer JJ, Wilson KL, Davison DK, Freel SA, Seedorff JE, Wring SA, Tvermoes NA, Matthews TJ, Greenberg ML, Delmedico MK.

DOI 10.1073/pnas.0701478104