To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
DRAVP ID DRAVPa1304
Peptide Name Sequence 5 from Patent US 5447915 A
Sequence ACYCRIPACIAGERRYGTCIYQGRLWAFCC
Sequence Length 30
Source Synthetic construct
Target Organism HIV
Patent Type Granted Patent
Publication Date 1995-09-05
Patent No US 5447915 A
Family Info CA 2077088 A1, WO 1991/013088 A1, US 5115098 A, EP 0517792 A1, JP H05503535 A, US 5447915 A
Patent Title Terminally blocked antiviral peptides
Comment No comments found in patent
Abstract This invention relates to antiviral peptide compounds and to methods of inhibiting infection of human cells by viruses. This invention pertains more specifically to peptides that are chemically blocked at the amino- and carboxy-termini. In particular the invention relates to peptides comprised of prolylalanine or prolylphenylalanine compounds that have antiviral activity. The invention is specifically directed to methods for preventing infection of human cells in vivo and in vitro with the human immunodeficiency virus HIV-1 and methods for treating human infected with this and other viruses. The invention also relates to the diagnostic and therapeutic use of these antiviral peptide compounds.
Other Link DRAVPe00299
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.