DRAVP ID  DRAVPe00299

Peptide Name   Neutrophil defensin 1 (Defensin, alpha 1; HNP-1, HP-1; Human, mammals, animals)

Sequence  ACYCRIPACIAGERRYGTCIYQGRLWAFCC

Sequence Length  30

UniProt ID  P59665  P11479  Q14125  Q6EZF6 

Taxon ID  None

Source  Homo sapiens (Human)

Other Link  DRAVPa1304

Validation   Experimentally Validated

Gene Name/ID  Not Available

GenBank  Not Available

Amino Acid position  Not Available

Domain Accession ID  Not Available

Nucleotide sequence ID  Not Available

Molecular Type  Not Available

Chromosomal Position  Not Available

Target Organism  SARS-CoV-2

Assay 

Activity 

• [Ref.34206990]SARS-CoV-2:inhibition of infection in HEK293T-hACE2 cells(approximately 50% inbibition at 1 μg/mL (290 nM));
• SARS-CoV-2 variant P.1:inhibition of infection in HeLa-hACE2 cells(67% inbibition at 50 μg/mL);
• SARS-CoV-2 variant B.1.1.7:inhibition of infection in HeLa-hACE2 cells(58% inbibition at 50 μg/mL).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity 

• [Ref.34206990]No cytotoxicity on HEK293T cells up to 50 μg/mL.

Binding Target  Not found

Mechanism  No machanism information found in the reference(s) presented in this entry

PDB ID  2KHT 

Predicted Structure Download  DRAVPe00299

Linear/Cyclic  Cyclic

N-terminal Modification  Free

C-terminal Modification  Cyclization(Cys2 and Cys30).

Other Modification  Disulfide bonds between Cys2 and Cys30,Cys4 and Cys19,Cys9 and Cys29.

Stereochemistry  L

Literature 1

Title   Human Defensins Inhibit SARS-CoV-2 Infection by Blocking Viral Entry.

Pubmed ID   34206990

Reference   Viruses. 2021 Jun 26;13(7):1246.

Author   Xu C, Wang A, Marin M, Honnen W, Ramasamy S, Porter E, Subbian S, Pinter A, Melikyan GB, Lu W, Chang TL.

DOI   10.3390/v13071246