General Information
DRAVP ID DRAVPe00299
Peptide Name Neutrophil defensin 1 (Defensin, alpha 1; HNP-1, HP-1; Human, mammals, animals)
Sequence ACYCRIPACIAGERRYGTCIYQGRLWAFCC
Sequence Length 30
UniProt ID P59665 P11479 Q14125 Q6EZF6
Taxon ID None
Source Homo sapiens (Human)
Other Link DRAVPa1304
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not Available
Activity Information
Target Organism SARS-CoV-2
Assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity
Binding Target Not found
Mechanism No machanism information found in the reference(s) presented in this entry
Structure Information
PDB ID 2KHT
Predicted Structure Download DRAVPe00299
Linear/Cyclic Cyclic
N-terminal Modification Free
C-terminal Modification Cyclization(Cys2 and Cys30).
Other Modification Disulfide bonds between Cys2 and Cys30,Cys4 and Cys19,Cys9 and Cys29.
Stereochemistry L
Physicochemical Information
Formula C150H228N44O38S6
Absent amino acids DHKMNSV
Common amino acids C
Mass 3448.09
Pl 8.68
Basic residues 4
Acidic residues 1
Hydrophobic residues 10
Net charge 3
Boman Index -3229
Hydrophobicity 30
Aliphatic Index 65.33
Half Life
Extinction Coefficient cystines 10345
Absorbance 280nm 356.72
Polar residues 13
Literature Information
Literature 1
Title Human Defensins Inhibit SARS-CoV-2 Infection by Blocking Viral Entry.
Pubmed ID 34206990
Reference Viruses. 2021 Jun 26;13(7):1246.
Author Xu C, Wang A, Marin M, Honnen W, Ramasamy S, Porter E, Subbian S, Pinter A, Melikyan GB, Lu W, Chang TL.