General Information


DRAVP ID  DRAVPe00299

Peptide Name   Neutrophil defensin 1 (Defensin, alpha 1; HNP-1, HP-1; Human, mammals, animals)

Sequence  ACYCRIPACIAGERRYGTCIYQGRLWAFCC

Sequence Length  30

UniProt ID  P59665  P11479  Q14125  Q6EZF6 

Source  Homo sapiens (Human)

Other Link  DRAVPa1304



Activity Information


Target Organism  SARS-CoV-2

Assay 

Activity 

  • [Ref.34206990]SARS-CoV-2:inhibition of infection in HEK293T-hACE2 cells(approximately 50% inbibition at 1 μg/mL (290 nM));
  • SARS-CoV-2 variant P.1:inhibition of infection in HeLa-hACE2 cells(67% inbibition at 50 μg/mL);
  • SARS-CoV-2 variant B.1.1.7:inhibition of infection in HeLa-hACE2 cells(58% inbibition at 50 μg/mL).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity 

  • [Ref.34206990]No cytotoxicity on HEK293T cells up to 50 μg/mL.

Binding Target  Not found

Mechanism  No machanism information found in the reference(s) presented in this entry



Structure Information


PDB ID  2KHT 

Predicted Structure Download  DRAVPe00299

Linear/Cyclic  Cyclic

N-terminal Modification  Free

C-terminal Modification  Cyclization(Cys2 and Cys30).

Other Modification  Disulfide bonds between Cys2 and Cys30,Cys4 and Cys19,Cys9 and Cys29.

Stereochemistry  L



Physicochemical Information


Formula  C150H228N44O38S6

Absent amino acids  DHKMNSV

Common amino acids  C

Mass  3448.09

Pl  8.68

Basic residues  4

Acidic residues  1

Hydrophobic residues  10

Net charge  3

Boman Index  -3229

Hydrophobicity  30

Aliphatic Index  65.33

Half Life 

  •     Mammalian:4.4 hour
  •     Yeast:>20 hour
  •     E.coli:>10 hour

Extinction Coefficient cystines  10345

Absorbance 280nm  356.72

Polar residues  13



Literature Information


Literature 1

Title   Human Defensins Inhibit SARS-CoV-2 Infection by Blocking Viral Entry.

Pubmed ID   34206990

Reference   Viruses. 2021 Jun 26;13(7):1246.

Author   Xu C, Wang A, Marin M, Honnen W, Ramasamy S, Porter E, Subbian S, Pinter A, Melikyan GB, Lu W, Chang TL.

DOI   10.3390/v13071246