Patent Information


DRAVP ID  DRAVPa1312

Peptide Name   Sequence 2 from Patent US 20100261876 A1

Sequence  YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF

Sequence Length  36

Source  Synthetic construct

Target Organism  HIV

Patent Type  Patent Application

Publication Date  2010-10-14

Patent No  US 2010/0261876 A1

Family Info  CA 2700354 A1, WO 2009/042194 A2, WO 2009/042194 A3, MX 2010003179 A, EP 2201028 A2, KR 20100080812 A, US 2010/0261876 A1, CN 101874038 A, JP 2010540528 A, BR PI0817697 A2

Patent Title  Novel Methods of Synthesis for Therapeutic Antiviral Peptides

Comment  No comments found in patent

Abstract  Provided herein are methods for synthesis of peptides. In particular, provided herein are methods of synthesis for therapeutic antiviral peptides.

Other Link  DRAVPe00520