To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
DRAVP ID DRAVPa1313
Peptide Name Sequence 3 from Patent US 20100261876 A1
Sequence MTWMEWDREINNYTSLIHSLIEESQNQQEKNEQELL
Sequence Length 36
Source Synthetic construct
Target Organism HIV
Patent Type Patent Application
Publication Date 2010-10-14
Patent No US 2010/0261876 A1
Family Info CA 2700354 A1, WO 2009/042194 A2, WO 2009/042194 A3, MX 2010003179 A, EP 2201028 A2, KR 20100080812 A, US 2010/0261876 A1, CN 101874038 A, JP 2010540528 A, BR PI0817697 A2
Patent Title Novel Methods of Synthesis for Therapeutic Antiviral Peptides
Comment No comments found in patent
Abstract Provided herein are methods for synthesis of peptides. In particular, provided herein are methods of synthesis for therapeutic antiviral peptides.
Other Link DRAVPe00255
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.