To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
DRAVP ID DRAVPa1745
Peptide Name P9
Sequence NGAICWGPCPTAFRQIGNCGHFKVRCCKIR
Sequence Length 30
Source Synthetic construct
Target Organism SARS-CoV-2
Patent Type Patent Application
Publication Date 2023-06-01
Patent No US20230165936 A1
Family Info WO/2021/185071，CN115379849，EP4121087
Patent Title Compositions of anti-viral peptides and methods of use thereof
Comment
Abstract Broad spectrum antiviral peptides and composition including therapeutically effective amounts of the antiviral peptides along with a pharmaceutically acceptable carrier are provided. The antiviral compositions show a strong broad spectrum antiviral effect, without resulting to viral resistance. The antiviral compositions are useful for treatment of diseases caused by viral infections, particularly respiratory viruses such as enveloped coronaviruses (SARS-CoV-2, SARS-CoV and MERS-CoV), the pandemic A(H1N1)pdm09 virus, avian influenza A(H7N9) virus, and the non-enveloped rhinovirus.
Other Link DRAVPe01761
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.