DRAVPR ID  DRAVPR0005

Name   HLA class II histocompatibility antigen gamma chain(CD74)

Sequence  MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKVLTKCQEEVSHIPAVHPGSFRPKCDENGNYLPLQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELEDPSSGLGVTKQDLGPVPM

Sequence Length  296

Source  Homo sapiens (Human)

UniProt ID P04233

Gene CD74

Target Organism  EBOV,SARS-CoV-2

Activity 

• [Ref.32855215]Ebola virus (EBOV):The p41 isoform of CD74 disrupts cathepsin-mediated Ebola glycoprotein processing, which prevents viral fusion and entry.
• SARS-CoV-2: CD74 p41 can stymie the endosomal entry of coronaviruses including SARS-CoV-2.

PDB ID  1A6A  1ICF  1IIE  1L3H  1MUJ  3PDO  3PGC  3PGD  3QXA  3QXD  4AEN  4AH2  4X5W  5KSU  5KSV 

Predicted Structure Download  AF-P04233-F1

Modification  ①Glycosylation of Asn at position 130,136,256.②There are three disulfide bonds between Cys213 and Cys232, Cys243 and Cys250, Cys252 and Cys271.③Glycosylation of Thr at position 203.④Glycosylation of Ser at position 281.

Has antiviral activity by stymieing the endosomal entry of Ebola virus and coronaviruses, including SARS-CoV-2

Literature 1

Title   MHC class II transactivator CIITA induces cell resistance to Ebola virus and SARS-like coronaviruses.

Pubmed ID   32855215

Author   Bruchez A, Sha K, Johnson J, Chen L, Stefani C, McConnell H, Gaucherand L, Prins R, Matreyek KA, Hume AJ, Mühlberger E, Schmidt EV, Olinger GG, Stuart LM, Lacy-Hulbert A.