DRAVPR ID  DRAVPR0011

Name   Ubiquitin-like protein ISG15(ISG15)

Sequence  MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGGTEPGGRS

Sequence Length  165

Source  Homo sapiens (Human)

UniProt ID P05161

Gene ISG15

Target Organism  HIV-1,EBOV,IAV

Activity 

• [Ref.16434471]Human immunodeficiency virus type-1(HIV-1):inhibits the ubiquitination of HIV-1-encoded Gag polypeptide and Tsg101 and the interaction of Tsg101, a central component of ESCRT-1 with the p6 domain of the Gag polyprotein, thereby preventing assembly and release of virions from infected cells.
• [Ref.18305167]Ebola virus(EBOV):inhibits Ebola virus budding mediated by the VP40 protein by disrupting ubiquitin ligase activity of NEDD4 and its ability to ubiquitinate VP40.
• [Ref.20133869]Influenza A virus(IAV):ISG15 modification of K41 of the NS1A protein inhibits influenza A virus replication and thus contributes to the antiviral action of IFN-β.

PDB ID  1Z2M  2HJ8  3PHX  3PSE  3R66  3RT3  3SDL  5TL6  5W8T  5W8U  6BI8  6FFA  6XA9  7RBS  7S6P 

Predicted Structure Download  AF-P05161-F1

Modification  The Cys at position78 indicates S-nitrosocysteine.

ISG15 may affect replication not only of HIV-1, but also of a broad group of RNA viruses.

Literature 1

Title   Innate antiviral response targets HIV-1 release by the induction of ubiquitin-like protein ISG15.

Pubmed ID   16434471

Author   Okumura A, Lu G, Pitha-Rowe I, Pitha PM.

Literature 2

Title   ISG15 inhibits Ebola VP40 VLP budding in an L-domain-dependent manner by blocking Nedd4 ligase activity.

Pubmed ID   18305167

Author   Okumura A, Pitha PM, Harty RN.

Literature 3

Title   ISG15 conjugation system targets the viral NS1 protein in influenza A virus-infected cells.

Pubmed ID   20133869

Author   Zhao C, Hsiang TY, Kuo RL, Krug RM.