DRAVPR ID  DRAVPR0013

Name   Interferon alpha-inducible protein 6(IFI6)

Sequence  MRQKAVSLFLCYLLLFTCSGVEAGKKKCSESSDSGSGFWKALTFMAVGGGLAVAGLPALGFTGAGIAANSVAASLMSWSAILNGGGVPAGGLVATLQSLGAGGSSVVIGNIGALMGYATHKYLDSEEDEE

Sequence Length  130

Source  Homo sapiens (Human)

UniProt ID P09912

Gene IFI6

Target Organism  HCV

Activity 

• [Ref.25757571]Hepatitis C virus (HCV):IFI6 inhibits HCV entry by disrupting EGFR activation and HRas/Raf-1 signaling and downstream CD81-CLDN1 interactions in response to HCV infection or CD81 crosslinking.

PDB ID  None

Predicted Structure Download  AF-P09912-F1

Modification  No modifications on the sequence.

IFI6 was one of a number of ISGs shown to inhibit yellow fever virus (YFV) infection in STAT1-deficient human.IFI6 suggests a block at a subsequent step in DENV replication.

Literature 1

Title   Interferon-α inducible protein 6 impairs EGFR activation by CD81 and inhibits hepatitis C virus infection.

Pubmed ID   25757571

Author   Meyer K, Kwon YC, Liu S, Hagedorn CH, Ray RB, Ray R.