DRAVPR ID  DRAVPR0022

Name   Mannose-binding protein C(MBP-C)

Sequence  MSLFPSLPLLLLSMVAASYSETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI

Sequence Length  248

Source  Homo sapiens (Human)

UniProt ID P11226

Gene MBL2

Target Organism  SARS-CoV-2

Activity 

• [Ref.35102342]SARS-CoV-2:MBL bound trimeric spike protein and then activated the lectin pathway of complement activation, which leads to the inhibition SARS-CoV-2 infection and a reduction of the induced inflammatory response.(Spike-mediated viral entry was inhibited by 90% at the concentration of 10 µg/ml(34 nM) in 293T cells, EC50= 0.5 µg/ml (1.7 nM)).

PDB ID  1HUP 

Predicted Structure Download  AF-P11226-F1

Modification  ①Hydroxylation of Pro at position 47,73,79,82,88.②There are two disulfide bonds between Cys155 and Cys244, Cys222 and Cys236.

MBL was found to interact with spike protein and have antiviral activity with an EC50 of approximately 0.08 μg ml–1 (0.27 nM) and an affinity of 34 nM.

Literature 1

Title   Recognition and inhibition of SARS-CoV-2 by humoral innate immunity pattern recognition molecules.

Pubmed ID   35102342

Author   Stravalaci M, Pagani I, Paraboschi EM, Pedotti M, Doni A, Scavello F, Mapelli SN, Sironi M, Perucchini C, Varani L, Matkovic M, Cavalli A, Cesana D, Gallina P, Pedemonte N, Capurro V, Clementi N, Mancini N, Invernizzi P, Bayarri-Olmos R, Garred P, Rappuoli R, Duga S, Bottazzi B, Uguccioni M, Asselta R, Vicenzi E, Mantovani A, Garlanda C.