DRAVPR ID  DRAVPR0031

Name   DNA dC->dU-editing enzyme APOBEC-3F

Sequence  MKPHFRNTVERMYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPRLDAKIFRGQVYSQPEHHAEMCFLSWFCGNQLPAYKCFQITWFVSWTPCPDCVAKLAEFLAEHPNVTLTISAARLYYYWERDYRRALCRLSQAGARVKIMDDEEFAYCWENFVYSEGQPFMPWYKFDDNYAFLHRTLKEILRNPMEAMYPHIFYFHFKNLRKAYGRNESWLCFTMEVVKHHSPVSWKRGVFRNQVDPETHCHAERCFLSWFCDDILSPNTNYEVTWYTSWSPCPECAGEVAEFLARHSNVNLTIFTARLYYFWDTDYQEGLRSLSQEGASVEIMGYKDFKYCWENFVYNDDEPFKPWKGLKYNFLFLDSKLQEILE

Sequence Length  373

Source  Homo sapiens (Human)

UniProt ID Q8IUX4

Gene APOBEC3F

Target Organism  HIV-1,XMRV

Activity 

• [Ref.15141007]Human immunodeficiency virus type 1(HIV-1):APOBEC3F induced G to A hypermutations in HIV genomic DNA at the step of reverse transcription in target cells and thus inhibited the replication of HIV-1.
• [Ref.20335265]Xenotropic murine leukemia virus-related virus (XMRV):the expression of APOBEC3F in virus-producing cells resulted in their virion incorporation, inhibition of XMRV replication, and G-to-A hypermutation of the viral DNA.

PDB ID  3WUS  4IOU  4J4J  5HX4  5HX5  5W2M  5ZVA  5ZVB  6NIL 

Predicted Structure Download  AF-Q8IUX4-F1

Modification  There is a disulfide bond between Cys280 and Cys283.

Exhibits antiviral activity also against hepatitis B virus (HBV), equine infectious anemia virus (EIAV), xenotropic MuLV-related virus (XMRV) and simian foamy virus (SFV).

Literature 1

Title   Human APOBEC3F is another host factor that blocks human immunodeficiency virus type 1 replication.

Pubmed ID   15141007

Author   Zheng YH, Irwin D, Kurosu T, Tokunaga K, Sata T, Peterlin BM.

Literature 2

Title   Inhibition of xenotropic murine leukemia virus-related virus by APOBEC3 proteins and antiviral drugs.

Pubmed ID   20335265

Author   Paprotka T, Venkatachari NJ, Chaipan C, Burdick R, Delviks-Frankenberry KA, Hu WS, Pathak VK.