DRAVPR ID  DRAVPR0041

Name   Interferon-induced transmembrane protein 2

Sequence  MSHNSQAFLSTNAGLPPSYETIKEEYGVTELGEPSNSAVVRTTVINMPREVSVPDHVVWSLFNTLFFNACCLGFVAYAYSVKSRDRKMVGDVVGAQAYASTAKCLNISSLIFSILMVIICIIIFSTTSVVVFQSFAQRTPHSGF

Sequence Length  144

Source  Mus musculus (Mouse)

UniProt ID Q99J93

Gene Ifitm2

Target Organism  SARS-CoV,IAV,EBOV

Activity 

• [Ref.21253575]influenza A virus(IAV):Ifitm2 inhibits infection mediated by the influenza A virus (IAV) hemagglutinin (HA) protein.
• SARS-CoV:IFITM proteins can restrict the replication of infectious SARS coronavirus (SARS-CoV) and entry mediated by the SARS-CoV spike (S) protein.
• Ebola virus(EBOV):IFITM proteins restricted infection mediated by the entry glycoproteins (GP1,2) of Ebola filoviruses.

PDB ID  None

Predicted Structure Download  AF-Q99J93-F1

Modification  ①Phosphorylation of Ser at position 19.②The Cys at position 70,71,104 indicates S-palmitoyl cysteine.

Active against multiple viruses, including influenza A virus, SARS coronaviruses (SARS-CoV and SARS-CoV-2), Marburg virus (MARV), Ebola virus (EBOV), Dengue virus (DNV), West Nile virus (WNV), human immunodeficiency virus type 1 (HIV-1), hepatitis C virus (HCV) and vesicular stomatitis virus (VSV)

Literature 1

Title   Distinct patterns of IFITM-mediated restriction of filoviruses, SARS coronavirus, and influenza A virus.

Pubmed ID   21253575

Author   Huang IC, Bailey CC, Weyer JL, Radoshitzky SR, Becker MM, Chiang JJ, Brass AL, Ahmed AA, Chi X, Dong L, Longobardi LE, Boltz D, Kuhn JH, Elledge SJ, Bavari S, Denison MR, Choe H, Farzan M.