DRAVPR ID  DRAVPR0047

Name   Interleukin-17A(IL-17)

Sequence  MSPGRASSVSLMLLLLLSLAATVKAAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA

Sequence Length  158

Source  Mus musculus (Mouse)

UniProt ID Q62386

Gene Il17a

Target Organism  H5N1,WNV

Activity 

• [Ref.21946434]H5N1:IL17A may play a beneficial role in influenza A virus (H5N1) infection by enhancing B cell recruitment and immune response in the lung.
• [Ref.27795421]West Nile virus(WNV):IL17A promotes CD8+ T cell cytotoxicity to facilitate west nile virus clearance.

PDB ID  None

Predicted Structure Download  AF-Q62386-F1

Modification  ①Glycosylation of Asn at position 71.②There are two disulfide bonds between Cys97 and Cys147, Cys102 and Cys149.

Viperin contains an N-terminal amphipathic α-helix that localizes to the cytosolic face of the ER and inhibits bulk protein secretion (22), which could impact virus production directly or indirectly. Viperin also inhibits farnesyl diphosphate synthetase, a cholesterol and isoprenoid biosynthesis enzyme, resulting in the inhibition of lipid raft formation and influenza virus budding

Literature 1

Title   A critical role of IL-17 in modulating the B-cell response during H5N1 influenza virus infection.

Pubmed ID   21946434

Author   Wang X, Chan CC, Yang M, Deng J, Poon VK, Leung VH, Ko KH, Zhou J, Yuen KY, Zheng BJ, Lu L.

Literature 2

Title   Interleukin-17A Promotes CD8+ T Cell Cytotoxicity To Facilitate West Nile Virus Clearance.

Pubmed ID   27795421

Author   Acharya D, Wang P, Paul AM, Dai J, Gate D, Lowery JE, Stokic DS, Leis AA, Flavell RA, Town T, Fikrig E, Bai F.