DRAVPR ID  DRAVPR0048

Name   Radical S-adenosyl methionine domain-containing protein 2(Viperin)

Sequence  MGMLVPTALAARLLSLFQQQLGSLWSGLAILFCWLRIALGWLDPGKEQPQVRGEPEDTQETQEDGNSTQPTTPVSVNYHFTRQCNYKCGFCFHTAKTSFVLPLEEAKRGLLLLKQAGLEKINFSGGEPFLQDRGEYLGKLVRFCKEELALPSVSIVSNGSLIRERWFKDYGEYLDILAISCDSFDEQVNALIGRGQGKKNHVENLQKLRRWCRDYKVAFKINSVINRFNVDEDMNEHIKALSPVRWKVFQCLLIEGENSGEDALREAERFLISNEEFETFLERHKEVSCLVPESNQKMKDSYLILDEYMRFLNCTGGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKYVWSKADLKLDW

Sequence Length  362

Source  Mus musculus (Mouse)

UniProt ID Q8CBB9

Gene Rsad2

Target Organism  WNV,SBV

Activity 

• [Ref.21880757]West Nile virus(WNV):viperin contributes to the antiviral responses against WNV in vivo, as the targeted deletion of viperin was associated with increased lethality and selectively enhanced replication in specific tissues.
• [Ref.17686841]Sindbis virus (SBV):viperin exhibited modest replication inhibition of sindbis virus in vitro.

PDB ID  5VSL  5VSM  6Q2P  6Q2Q 

Predicted Structure Download  AF-Q8CBB9-F1

Modification  The Lys at position 198 idnicates N6-acetyllysine.

Viperin, a member of the radical S-adenosyl-L-methionine (SAM) superfamily of enzymes, implicated in inhibiting the replication of a remarkable range of RNA and DNA viruses, including dengue virus, West Nile virus, hepatitis C virus, influenza A virus, rabies virus2 and HIV.Viperin suppresses the replication of influenza A and HIV-1 by blocking the release of viral particles, interacts with the RC of HCV and DENV to inhibit viral replication by binding with the nonstructural HCV protein NS5A and the DENV NS3 protein

Literature 1

Title   Identification and characterization of interferon-induced proteins that inhibit alphavirus replication.

Pubmed ID   17686841

Author   Zhang Y, Burke CW, Ryman KD, Klimstra WB.

Literature 2

Title   The interferon-inducible gene viperin restricts West Nile virus pathogenesis.

Pubmed ID   21880757

Author   Szretter KJ, Brien JD, Thackray LB, Virgin HW, Cresswell P, Diamond MS.