DRAVPR ID  DRAVPR0118

Name   Interferon-induced, double-stranded RNA-activated protein kinase(PKR)

Sequence  MASDTPGFYMDKLNKYRQMHGVAITYKELSTSGPPHDRRFTFQVLIDEKEFPEAKGRSKQEARNAAAKLAVDILDNENKVDCHTSASEQGLFVGNYIGLVNSFAQKKKLSVNYEQCEPNSELPQRFICKCKIGQTMYGTGSGVTKQEAKQLAAKEAYQKLLKSPPKTAGTSSSVVTSTFSGFSSSSSMTSNGVSQSAPGSFSSENVFTNGLGENKRKSGVKVSPDDVQRNKYTLDARFNSDFEDIEEIGLGGFGQVFKAKHRIDGKRYAIKRVKYNTEKAEHEVQALAELNHVNIVQYHSCWEGVDYDPEHSMSDTSRYKTRCLFIQMEFCDKGTLEQWMRNRNQSKVDKALILDLYEQIVTGVEYIHSKGLIHRDLKPGNIFLVDERHIKIGDFGLATALENDGKSRTRRTGTLQYMSPEQLFLKHYGKEVDIFALGLILAELLHTCFTESEKIKFFESLRKGDFSNDIFDNKEKSLLKKLLSEKPKDRPETSEILKTLAEWRNISEKKKRNTC

Sequence Length  515

Source  Mus musculus (Mouse)

UniProt ID Q03963

Gene Eif2ak2

Target Organism  RSV, LCMV, SFV

Activity 

• [Ref.21994357]respiratory syncytial virus(RSV):a lack of PKR in vivo results in altered immunoglobulin G secretion in response to respiratory syncytial virus (RSV) infection.
• [Ref.20585572]lymphocytic choriomeningitis virus (LCMV):PKR activity could be a distinguishing feature between Type I IFN actions that mediate viral control or stimulate CD8 T cell expansion during an acute infection with lymphocytic choriomeningitis virus (LCMV).[Ref.19264662]Semliki Forest virus(SFV):In mouse embryo fibroblasts (MEFs), PKR delayed virus protein synthesis, production of infectious virus and caspase-3-activated cell death and reduced the yield of infectious virus by 90 %.

PDB ID  1X48  1X49 

Predicted Structure Download  AF-Q03963-F1

Modification  ①The N-terminal is acetylation.②Phosphorylation of Thr at position 84, 233, 409, 414.③Phosphorylation of Tyr at position 96, 157, 268.④Phosphorylation of Ser at position 419.

In response to SFV, PKR exerts an early antiviral effect that delays virus protein production and release of infectious virus.

Literature 1

Title   Protein kinase R is a novel mediator of CD40 signaling and plays a critical role in modulating immunoglobulin expression during respiratory syncytial virus infection.

Pubmed ID   21994357

Author   Thakur SA, Zalinger ZB, Johnson TR, Imani F.

Literature 2

Title   Role of PKR and Type I IFNs in viral control during primary and secondary infection.

Pubmed ID   20585572

Author   Nakayama Y, Plisch EH, Sullivan J, Thomas C, Czuprynski CJ, Williams BR, Suresh M.

Literature 3

Title   PKR acts early in infection to suppress Semliki Forest virus production and strongly enhances the type I interferon response

Pubmed ID   19264662

Author   Barry G, Breakwell L, Fragkoudis R, Attarzadeh-Yazdi G, Rodriguez-Andres J, Kohl A, Fazakerley JK.